KEGG   Cryptococcus gattii: CGB_I4160CHelp
Entry
CGB_I4160C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cgi  Cryptococcus gattii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGB_I4160C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CGB_I4160C
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CGB_I4160C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(join(842133..842298,842426..842566,842669..842896,842947..843044))
Genome map
AA seq 210 aa AA seqDB search
MLFGLFLFTSLYIVFSFGPHIKTMKAYIYDDKPGDQRLPHDTGIDIPEPTLAKLGVIYRR
ISIDSEGVWESKIDEFAKERGYKNRDRITVTREGLGEAYEEKIKSFFDEHLHEDEEIRYI
LAGSGYFDIRGAEGVHEEQWIRIALEAGDLIVLPAGIYHRFTVDSANTITAMRLFQDEPK
WTPYSRQADGTDKLGSRDKYLETVRVGVAA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcggcttgtttttattcaccagcttgtacatcgttttcagcttcggcccacac
attaaaacaatgaaggcatacatttacgacgacaagcctggagaccaacgtctccctcac
gacaccggcatcgacatcccggaacccacccttgccaaactcggcgtcatctatcggcgc
atatccatcgattctgaaggcgtttgggaatccaagattgacgagtttgcaaaggagcga
ggctacaaaaaccgggatagaattaccgtcactagggaagggttgggagaggcctatgag
gaaaaaattaagtcgttctttgacgagcatttgcatgaagatgaagagattcgatatatc
ctggcgggatcgggctactttgatattcgaggtgcagaaggagtgcatgaagagcaatgg
atcagaattgcactcgaagctggcgacttgatcgtccttcccgccggtatctatcaccgc
ttcacagtcgactctgcaaacaccataacagccatgcggctcttccaggatgaacccaaa
tggacaccctactcccgacaggcggatgggacggacaagttaggaagcagggataaatac
ctggagaccgttagggttggtgttgctgcttga

DBGET integrated database retrieval system