KEGG   Cryptococcus gattii: CGB_I4200WHelp
Entry
CGB_I4200W        CDS       T02232                                 

Definition
histone deacetylase 1 (hd1)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CGB_I4200W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:join(856074..856418,856475..856592,856650..856724,856778..856889,856944..857112,857165..857257,857307..857415,857485..857560,857612..857695,857751..857840,857905..858053,858157..858605)
Genome map
AA seq 622 aa AA seqDB search
MGPAQPPIDPSPPPSSSSSRRVAYYYDQDVGNYNYYLGHPMKPHRIRMAHNLIVNYGMCD
EEGQEHGPAEVWGEGKRMVNDEMAQNWGGGLMGEAEMKWEKAALSGSRSKMMQVFKPRRA
TKEEMTRFHTDEYIDLLEAVTPETADALTGGGTRCLIGEDCPAFDGLFEFCTISAGGSLG
AAERLNAGAADIVINWAGGLHHAKKTEASGFCYVNDIVLGILELLRIHPRVLYIDVDVHH
GDGVEEAFYVTDRVMTCSFHRFGEFFPGTGDVRDVGMKKGKGYAVNVPLRDGITDETFQS
IFKPVIDRIMSHFRPSAVVLQMGADSISGDKLGGFNLTLEGHAECARFIKGFNVPVMMVG
GGGYTVKNVARAWTKETAIMCGVDLPEDLPYNQFLEYYGPRYKLEVLPTNAVDHNPPEYL
ERIKNQVFENLRNLPFAPSAQMRSVPSKTIGQVLGITDGGDEEPEDEIDQRIKKLLKRRR
ANALDGDVSSSSESEIDTPAFSRPGRARRQGGNFSGRGRSSRLAQLQHNRERREAAQEAS
NGMEDDPCGVLGKKKRSFFKVVPKLNGVGVEPVDTSAVGFGIGVVNGGFNGVGLKERLGI
PVVEQWKGNGVMSRAGTPASMA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgcccagccaccgatagacccttccccacctccatcttcttcctcctcacgc
agggtcgcatactattacgatcaggatgtgggcaactataactactatctcggccatccc
atgaagccccaccgaataaggatggctcacaatttgattgtcaactacgggatgtgtgat
gaggaagggcaggagcatggccctgccgaagtatggggcgaaggaaagaggatggtgaat
gacgagatggcccaaaattggggaggaggcctgatgggtgaggcagagatgaagtgggaa
aaggcggcgttgagtggatcaaggagtaagatgatgcaggtttttaaacctcgaagggct
accaaagaagaaatgactcggtttcacacggatgaatatatagatctgctagaggctgtt
accccggagactgcggatgctttaacaggcggcggaacgaggtgcctcattggtgaggac
tgtcccgcgttcgacgggctattcgagttttgcaccatctctgcaggtggatcattaggt
gctgctgaacgtctgaacgccggtgcagctgacatcgtaatcaactgggctggtggtctg
catcacgccaagaagactgaagcaagtggtttctgctacgtgaatgacattgtcctgggt
atcctcgagcttcttcgaatacatccccgggttctttacattgatgtggacgtacaccac
ggagacggtgtggaggaagcgttctacgtaacggatagggtcatgacttgtagcttccac
cgatttggagaattcttccccggtacaggtgatgtcagggatgttggtatgaagaaagga
aaaggctacgccgtgaacgtcccgctccgagacggtatcaccgatgagactttccaatca
atattcaagccggtgattgaccgtatcatgtcacacttccgacccagcgctgtagtcctt
caaatgggtgccgattctatatcaggcgacaaactcggtggctttaatctaactttggaa
ggtcacgcggagtgtgcgagattcatcaagggcttcaacgtacctgttatgatggtcggt
gggggcggatatactgttaaaaatgttgcaagggcttggactaaggagactgcaatcatg
tgcggcgtggatcttcctgaggacttgccttacaatcaattcttggaatactacggaccc
cgatataagcttgaagttttgcccaccaatgccgtagatcataatccccccgagtacttg
gagcgtattaagaatcaagtgtttgagaacctccgaaatcttccatttgctccttccgct
caaatgcgttctgtcccaagcaagactattggccaggttttgggtataacggatggcggt
gatgaggaacccgaagatgagattgatcagcgtataaagaaattgctgaaacgtcgccga
gccaatgccctagacggtgacgtctcttcgtcttccgaatccgaaatcgacactccggcc
ttctcccgtcccggacgagccagacgtcaaggtggcaatttctccggccgtggtcgctca
tcccgtcttgctcaactacaacataaccgcgaaaggagagaagcagcacaggaagcgtcc
aacggaatggaagatgatccttgcggtgtattgggaaagaagaagaggagtttcttcaag
gtggtccccaagttgaatggtgtgggggttgagccagtagacacgagtgctgtgggtttt
gggattggggtggtgaatggtggattcaatggtgtaggactgaaggagaggttggggata
ccggtagtagagcagtggaaaggaaatggggtcatgtcgagagctggaacgccagcaagt
atggcgtga

DBGET integrated database retrieval system