KEGG   Cryptococcus gattii: CGB_I4430CHelp
Entry
CGB_I4430C        CDS       T02232                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGB_I4430C
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CGB_I4430C
Enzymes [BR:cgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CGB_I4430C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(join(924952..925089,925174..925311,925391..926131,926221..926333,926399..926572,926638..926753,926853..927022,927107..927166))
Genome map
AA seq 549 aa AA seqDB search
MSSEKAEFDAEVKAFEAFAKSPRFARTTRPYTPADVVSKRGTLPISYPSDVQAKKLWKIL
ESKARGEGGGCTATYGALDPVQLTQMAKYLETVYVSGWQCSSTASSSLEPGPDLADYPSN
TVPNKVAQLFTAQLYHDRKQRYTRSAALAKGQDPGERIDYLRPIVADADTGHGGLTAVMR
LTKMMVESGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAMRLQCDIMGTTNLVV
CRTDSEAATLLSTNIDPRDHSFILGSTNPSLPPLNDLMIAAEMEGKYGQELQKIEDAWTK
QAGLKLWPDVLADALSKHGVSSKRIAEFREQSIGTSHASTLQLAHSFGLPASATPYWSWD
TPRSREGYYRYQGGTQCAINRAIAFAPYADLLWMETKSPIYAQAKEFADGVHKVHPGQWL
AYNLSPSFNWEKAGLGKKEMKEYVWELGKLGFIFQFITLAGLHSNAYINDLFANAFSKEG
MKAYVELIQSREREIGCDVLTHQKWSGADYADALLMTVTGGVSSTAAMGKGVTENQFVDD
KTKDVLHKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgagaaagcagagtttgacgccgaagtcaaagcctttgaggcttttgccaag
tctccacgattcgcacgaacaacccgcccatacacccctgcagacgtcgtctcaaaacgt
ggcactctccccatctcttacccctcagacgtccaagccaagaagctgtggaagatcttg
gagtcgaaagcccgaggagagggtgggggatgtaccgctacttatggagcgcttgaccca
gtgcagttgactcaaatggctaaatatcttgagacagtatacgtctctggctggcaatgt
tcttccactgcttcatcttccctcgaacctggacccgaccttgccgactatccatccaat
accgtccccaacaaagtcgcccaactcttcactgcccaactttaccacgaccgcaaacaa
cgatacacccgttccgccgctttggccaaaggccaagacccaggagagaggattgattac
ctcaggcctatcgtggcggacgctgatactggacatggtggtttgacggcagtgatgagg
ttgacaaagatgatggttgagagtggagcagcggggatccatatcgaggatcaagcgcct
ggtacgaagaagtgtggtcatatggctggtaaggtcctcgtccccatctccgaacacatc
aaccgcctcgtcgccatgcgtctccaatgcgacattatgggcaccaccaacctcgtcgtc
tgccgtaccgactctgaagccgccacccttctctccaccaacattgaccctcgggaccat
tccttcatcttgggttctaccaacccttccttaccccctcttaacgatctcatgatcgcc
gccgagatggagggcaagtacggacaagagctccagaaaatcgaggatgcatggacgaaa
caagcaggattaaaactatggccggacgtactcgccgacgctctttccaaacatggtgtc
tcctctaaaagaatcgccgagtttagagaacagtcgatcggcacatcacatgcttccacc
ctccagcttgcccactctttcggtctccctgcctccgccaccccttactggtcatgggac
accccccgttcccgcgagggttactaccgctaccaaggcggcacccaatgcgctataaac
cgtgccattgcatttgcaccttatgccgatctcctttggatggagaccaagtcccccatc
tacgcgcaagccaaagagtttgccgatggggtacataaggtccatcctggtcagtggttg
gcgtacaacttgagcccaagtttcaattgggaaaaggcagggttggggaagaaggagatg
aaagagtatgtgtgggagttgggaaaacttggtttcatcttccagttcatcacactcgcc
ggtcttcactccaacgcctatatcaacgacctcttcgccaacgcgttctcaaaggaaggt
atgaaggcctatgtcgagttgatccaaagccgagaacgggagattggatgtgatgtcttg
actcatcaaaagtggtcaggcgcagactatgcagacgcattgttgatgacggtcactggc
ggcgtttcctctaccgctgctatgggtaaaggcgtgaccgaaaatcagtttgtagatgat
aaaaccaaggacgttttgcataagctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system