KEGG   Cryptococcus gattii: CGB_J0160WHelp
Entry
CGB_J0160W        CDS       T02232                                 

Definition
clathrin heavy chain 1
Orthology
K04646  
clathrin heavy chain
Organism
cgi  Cryptococcus gattii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CGB_J0160W
Exosome [BR:cgi04147]
 Exosomal proteins
  Proteins found in most exosomes
   CGB_J0160W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:join(51260..51515,51565..51737,51779..52400,52440..53552,53607..55309,55362..55472,55528..55579,55630..55670,55720..55789,55843..55979,56030..56332,56388..56594,56649..56845,56899..56968)
Genome map
AA seq 1684 aa AA seqDB search
MAAPEKPIVFTEHMQLTALGIQPTSISFQTLTLESDAWICVRENGDTPQVVIVNLNDAGD
VVRRPITADSAIMNPRANEKILALKAGRQLQVFNLGAKAKLGTHLMNDDVTFWTWISDST
LGIVTEREVYHWKVMDGQMAPTKVFDRHANLTANQIINYRISHDEKWLVLVGISSNPNAG
QPGENGFKIKGAMQLYSIERGVSQPIEGHAATFASIKLDGASNPTKLFAFAVRSAAGAKL
HIVEIGHQAPNPPFQKKAVDVFFPPEALNDFPVSLQVSQKHGILYLVTKFGFIHLYEIET
GQCIYMNRISGETIFTTAEYASLSGIIGVNRKGQVLSVSVDEETIVPYIQQTLNNPELAI
KLATRAGLPGADGMIQQQYQVYIQNGQYGEAAKVAANSPRGLLRTPQTIETLKNLPAVPG
TLTPILQYFGILLEKGELNKYESLELARPVVQQGKKQLLEKWLKENKLESSEELGDLCRM
ADMNLALSVYLRANVPNKVVACFAELGQFDKIVLYSKKVGYTPDYAQLLQHLVRINPDKG
AEFATQLVNDENGPLVDLDRIVDIFMSQNMLQQATSILLDALKDNKPEQGPLQTRLLEMN
LMSAPQVADAILGNEMFTHYDRPRIANLAEKAGLVQRALEHYEDINDIKRVVVHTNLFKP
EWLVDYFGRLTVEQSFACLQEMLRTNLRQNLPIVVQIATKYSDLLGPVKLIELFEQFKSS
DGLYYYLGSIVNLSEDPEVHFKYIQAATRTGQIREVERICRESNFYSPEKVKNFLKEARL
DDQLPLIIVCDRFDFVHDLVLYLYQNGLTNFIEIYVQRVNSARTPQVIGGLLDVDCDETT
VKNLLMSVTGTFPIDELVDEVEKRNRLKLILPWLNNKVEQGSTDHSVYNAIAKISIDSNS
NPEKFLKENNLYDPAIVGKYCEKRDPYLAYIAYAKGFCDDELINITNENQMYKHQARYLV
KRRDLDLWTQVLNPESIHRRALIDQIIATAIPECIDPDDVSVTVKAFMHMELHGPLLELL
EKIIIEPSPFSDNRSLQSLMFLTAIKNDKGKVMGYINKLSGYDVETIAKVATEAGLYEEA
FTIYQRHDMHAEAMSVLVEHMASIDRGFAYANKINEPAVWSRLGKAQLDGLRVKEAIDSY
IKADDPSNFEEVIEIANRAGKHDDLVRYLQMARKTAREPKIDTELAYAYAKTDRLHDMEE
FLGMTNVADVLQVGEKCFEDELYQAAKLLFSSISNWARLATTLIYLGENQAAVDAARKAG
NTQVWKQVNAACVDKKEFRLAQICGLNLVVHAEELPALLSLYERNGYFDEIISLMEAGLG
LERAHMGMFTELSVLYAKYRPEKLMEHLKLFWQRVNIPKVIKAAEQAHLWPELVFLYIVY
DEPDNASLAMMERLAEWDHDQFKKVIVKVANMEIAYRAVSFYLARQPTLLPDLLAALTPR
LDHSRVIKILQTEDHLPLAKPYLIATQKLNLAVINEAYNDLLIEEEDHVTLRSSLETYDE
YDAIKLAKRLEKHELLEFRRIAALLYRLNSLWEESISLSKADRLWRDALETAAASKDIAV
CEELAGYFVSIGNKDAFAAILYVCFDFVRADFVEEMSWRFGLSDYSMPYKLQQQRDQATK
IAALEKEVKELRTKTAEKEPDNEPSSLMGSGLGGRLMIGGPSGGPPFMGSMPNGGMMAQP
TGFY
NT seq 5055 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgccagagaagcctatcgtgttcactgaacacatgcaactcacagccctcggc
atccaacccacttctatctccttccaaacgctaacgctcgaatctgatgcctggatttgt
gtcagagaaaatggcgatacacctcaagtcgttattgtcaacttgaacgatgctggcgat
gtcgttaggaggcctatcacggctgattcggctatcatgaaccccagagcaaacgagaag
atcttggctcttaaggccggtcgacagctccaagtgttcaacctcggggccaaagccaag
cttggtacccacctcatgaacgacgatgtgactttctggacttggatcagcgatagtact
ttgggtatcgttaccgaacgagaagtgtatcactggaaggttatggatggtcagatggct
ccgactaaggtgtttgaccgacacgccaacctcactgcgaaccaaatcattaactataga
atatcacacgacgaaaaatggcttgtccttgtcggtatctcttctaaccccaacgccggt
caacccggtgagaacggtttcaagatcaagggcgccatgcaactttattctatcgagaga
ggcgtctcccaacccatcgaaggtcacgctgctacattcgcttccatcaagctcgacggc
gcttccaaccctaccaagctgtttgcctttgcagttaggtctgcagctggagccaagttg
cacattgttgagattggccaccaggcaccaaaccctcccttccagaagaaggctgtcgat
gtgttcttccctcccgaggctttgaacgacttccccgtctctttgcaagtctctcagaag
cacggtattctttacctcgtcaccaagtttggtttcatccacctttatgaaattgaaacc
ggtcaatgtatctacatgaataggatttctggcgagactatcttcaccaccgccgagtac
gcgtccttgtcaggtatcatcggagttaacaggaagggtcaggttttgagtgttagcgtg
gacgaggagactattgtgccctatattcaacaaactctcaacaacccggagctcgctatc
aagcttgctactcgtgccggtcttcctggggccgacggtatgatccaacagcagtaccaa
gtctacatccagaacggccagtacggcgaggctgccaaagttgccgccaactctccccgt
gggttgttgcgtaccccacagaccatcgagactctcaagaacctccccgctgttcctggt
acccttactcctatcttgcagtactttggcatcttgctcgagaagggagaactcaacaag
tacgaatctcttgaacttgcccgtcctgtcgtacagcaaggcaagaagcagcttctcgaa
aagtggctcaaagagaacaagctcgagagtagtgaggagctcggtgacctctgtcgaatg
gccgatatgaacctcgctctctccgtttaccttcgcgccaacgttcctaacaaggtcgtc
gcctgtttcgccgagctggggcagtttgacaagattgttctctactccaaaaaggtcggc
tacactcccgactatgctcagcttctccagcaccttgtgcgtatcaaccccgacaagggt
gccgagtttgctacacagctcgtcaacgatgagaacggtcctctcgtcgaccttgaccga
atcgtcgatatcttcatgtctcagaacatgctccagcaagccacctctatcctcctcgac
gcactcaaggacaacaagcccgaacaaggtcctctccagacaaggttgctggagatgaac
ttgatgagcgctcctcaggtcgcggatgccattttgggcaatgaaatgttcacccattat
gacaggcctaggatcgccaacctcgccgagaaggcgggccttgtgcagagggctttggag
cactatgaggatatcaatgatatcaagagagttgttgtacacaccaacttgttcaagccc
gaatggttggtggactactttggacgactcacagtcgagcaaagcttcgcttgtttgcaa
gagatgttgaggaccaatttgaggcaaaacttgccgatcgtcgtgcagatcgctaccaaa
tactctgatttgcttggtcctgttaagctcatcgaattgtttgagcagtttaagagttct
gacggtttgtactactaccttggttccattgtcaacctcagcgaagaccccgaggttcat
ttcaagtacatccaagctgctactcgtaccggccagattcgcgaggtcgagcgtatctgc
cgagagtccaacttttacagccctgaaaaggtcaagaacttcctcaaggaagcacgtctt
gacgatcagctccctcttatcattgtctgcgaccgattcgactttgtacacgatttggta
ctctacctttaccagaacggtttgaccaactttattgagatttacgttcagcgagtcaac
tccgctagaacccctcaggttatcggtggattgctggatgttgactgcgatgagacgacg
gtaaagaacttattgatgagtgttaccgggaccttccccattgacgaactggtggatgaa
gtcgagaagcgaaacaggctcaagctcatcctgccttggcttaacaacaaggttgagcag
ggttctacagaccactcagtttacaacgccatcgccaagatctctatcgactcaaacagc
aatcccgaaaaattcctcaaggagaacaatctttacgatcccgctatcgtcggcaagtac
tgcgagaagcgtgatccttaccttgcctacattgcttacgccaagggtttctgtgatgat
gagctcatcaacattaccaacgagaaccaaatgtacaagcatcaggcacgatacctcgtt
aagcgacgcgaccttgacctctggacacaagttctcaaccccgagtctatccatcgccgt
gcccttatcgaccagatcatcgccactgccatcccggagtgcatcgaccctgatgatgtg
tccgtcaccgtaaaggcgtttatgcacatggaacttcacggccccttgcttgaattgctc
gaaaagattattattgagccatcacctttcagcgacaaccgttctttgcagagcttgatg
ttcctcaccgctatcaagaacgacaagggcaaggttatgggctacattaacaagctttcg
ggatacgacgtcgagactatcgccaaggtcgccaccgaggccggtctttacgaggaggcg
ttcaccatttaccagaggcacgacatgcacgccgaggcaatgagtgtccttgttgagcac
atggcttctatcgaccgaggttttgcctacgccaacaagatcaacgagcccgctgtctgg
agcagactcggtaaagcccagcttgacggtttgcgtgtcaaggaggccattgactcttac
atcaaggccgacgacccatccaacttcgaggaagttattgagattgccaaccgggctggc
aagcatgatgacctggtgcgataccttcaaatggccaggaagactgcccgcgagcccaag
attgatactgagcttgcttacgcgtacgcgaagactgaccgattgcacgatatggaagag
ttcctcggcatgaccaatgtcgccgacgtcttacaggtcggtgagaaatgtttcgaggat
gagctttaccaggccgccaagctcttgttctcaagcatttccaactgggccagattggca
actactttgatctacttgggcgagaaccaggcggcggttgatgcagctaggaaagcgggg
aacactcaagtgtggaagcaggttaacgccgcttgtgtggataagaaggagttcaggttg
gcgcagatttgtggtttgaaccttgtcgttcacgccgaggaacttcctgctttattgtca
ctttacgaaagaaatggctactttgacgaaatcatctccttgatggaagctggtttgggt
ttggagagggcccacatgggcatgttcacggaactgagcgtcttgtacgctaagtaccga
ccagaaaagctcatggagcacttgaagctcttctggcagcgtgtcaacattcccaaggtc
atcaaggctgccgaacaggcccatctctggcccgagcttgtcttcctgtacattgtctac
gatgaacccgacaacgcttctttggctatgatggagcgcctcgccgagtgggatcacgat
cagttcaagaaagtgatcgtcaaggttgccaacatggaaattgcctaccgggccgtctcc
ttctatcttgctcgacaacccacccttctccccgatcttcttgctgccctcaccccccgt
cttgaccacagtcgagttatcaagatcctgcaaaccgaagaccatcttcccctcgccaag
ccttacctcattgccacccaaaaactcaacctcgccgtcatcaacgaagcctacaatgat
ttgcttattgaagaggaggaccatgtcactttacgaagcagtctggagacttatgatgag
tacgatgcgatcaagttggcaaagagattggagaagcatgagttgttggaattcaggaga
attgctgctttgctttaccgactcaactccttgtgggaagagtccatttctctctcaaag
gccgatagattatggcgagatgctcttgagactgctgcggcgagcaaggacattgccgtt
tgtgaagagcttgctggctattttgtttctattggaaacaaggatgctttcgcagctatt
ctttacgtctgcttcgactttgtccgagctgactttgttgaggaaatgtcttggcgattc
ggcctgtcagattactctatgccttacaagctccagcaacagcgagaccaagctaccaag
attgcagcgcttgaaaaggaggttaaggagcttagaactaagaccgctgagaaggagccg
gataatgagccgagtagtttgatgggatctggattgggtgggagattgatgattggcgga
ccttcgggcggaccacccttcatgggtagtatgcccaatggaggtatgatggctcaaccc
accgggttctactaa

DBGET integrated database retrieval system