KEGG   Cryptococcus gattii: CGB_J0390WHelp
Entry
CGB_J0390W        CDS       T02232                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cgi  Cryptococcus gattii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_J0390W
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CGB_J0390W
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CGB_J0390W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:join(106198..106398,106442..106608,106659..107233,107282..107873,107919..108858,108908..109001,109057..109295,109357..109480,109535..109709,109760..110096,110150..110303,110354..110565,110622..110901,110950..111146,111203..111406,111458..111547,111602..111704,111766..111863)
Genome map
AA seq 1593 aa AA seqDB search
MTILDSLKPSNIEIPLPKAVPQAEGKKTPKTPQDEAISFFSGEGDGEPVQVWELSLEDDG
GPSPEKSYLRLPPPFKPYVLRFTLQPGTDVTRNGVLKSDFPMDGGAFKRDDWKERKLPSD
LSRPIEVDLPISAPGAFCYFIEYDSPDSTGRVQGRKGYFNVDPIITLPARSPFFPPDTPM
ASGPLKEESSGAILPKDKQLSLDSLIIISVLAKWMGKTTEWEPFFAEASRRGYNMLHWAP
LQQKGVSGSPYSIQNQLVFDADLLKDPKAKDGGVKEIEEVLKFAKEKYGLGGVTDVVLNH
TAYDSPWLQEHPEAGYSPYNTPHLAPALEFEDALLSLTTRLSSLGLPTNLKSESDLQALI
PHIKSSIDDAKLWEYYVFDVQGSERAIADSLLNSKPEAPKPWDGVSLQGKTLDELADIVK
SSNIITSYRAYSSRYCTSVSPAVAAGFIQAAYPGDSAENQASRWGKILDVLNVNLYKEYN
EDIQTGIDGVVGRLRYTRLEEGGPKLGELTKERAIVERYFTRIPKSDITKKHPESALAVA
NNGWMWAADPLNNFAEYPSKAYLRRQVIVWDDCVKLRYGSQPSDNPWLWQHMISYAELLA
GMFDGFRLDNCHSTPLPLGKAVIDAGRRINPNLYIMAELFTGSQEMDLKFVRELGINSLV
REAYNGNTVKNFADLLWRFGLGKPVGSMDVACLTSSGEVHLNLSSSKSSARPARVTPLQG
SVPHAVFYDLTHDNQSPRDKRTAEDALSTGALVTFCAAALGSNKGFDDLYPKLLDLVTDN
RKYEVISNEKEKSSGIGNVKRVLNALHVEMMEGGYSEGYVHEDGEYLMIHRVHPITHKGY
MLVAHTAYPGFKGRGWVKPIRLGRTSISYIFGACIKTRFEEWKDDPSTHRGIPSTLGEIP
PPEITKGTGNGEEYQEVVVPEDFAPGSIMVFATQMSDISGDLDAFCKEGAIEAMSQLDLV
DLNVILHRADSEERDATGGDGTYTIPNYGPITFCGLEGWMHPLREITKKNDLGHPLCQHL
REGTWAFDYVVNRLNKQTGDLPHLAAPAKWFASRFDQIKATAPSFMRPKYFSLVIHEAYK
AARRAVVEQCSEFVSSGHSFIHNLALCSVQMYGLVKSASLDPGKPVPSLAAGLPHFSAGW
ARCWGRDVFISLRGLFLTTGNYPAARAHILSFGSTLKHGLIPNLLDSTRNPRYNCRDGPW
WFIQNVQDYTHMAPNGLTILSDKVKRRFPADDTWVPWNSPRAYEYESSVAELIQEILQRH
AEGIEFREYNAGPNLDMDMRDEGFNQKIWVDWDTGIIFGGNRYNCGTWMDKMGSSEKAGN
KGLPATPRDGAPIEITGLLKSALTWLDKLSKGGKFPFKGVNASVKGQKRLVTYKEWSDLI
QASFEKHYYVPSDPAEDDKYVINKGLVNRRGIYKDVFGTPKDREWSDYQHRCNFTLPMIV
APELFTPSKALEALRIADAVLRAPLGMKTLDPSDSQYRGDYENSNDSTDQAIAKGWNYHQ
GPEWGFPLGWFLMAYLKFDRLAGEGKSSPTKTMHYISNILRNLARHIENDPWRGLPELTN
SNGSFCYDSCNTQAWSASTILDVLEEMHKSGKN
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgactatcctcgactccctcaaaccaagcaacattgagatccctttgcccaaagctgtc
ccccaggctgaaggcaagaagactcccaagacaccacaagatgaagccatctccttcttc
tctggagagggggatggcgagccagtgcaggtctgggaactatctttggaggatgacgga
ggtcctagtcccgagaagagttaccttcgacttccccctccgtttaagccgtatgtcttg
aggtttactcttcagcctggtacggatgtgactcgtaatggtgtgcttaaaagcgacttc
ccgatggacgggggcgcgtttaagcgtgatgactggaaagagcgaaagttgccctccgac
ctgagcagacctatcgaggtcgaccttccaatctccgctcccggagcattctgctacttt
atcgaatatgactcgcccgattctacaggtcgagttcaaggccggaaaggctactttaac
gttgaccccatcatcactcttcccgctcgtagcccattcttccctcccgatacccccatg
gcatccggccctctgaaagaggagtcgtcaggtgccatccttccaaaggacaagcagctt
agtctcgatagtcttatcatcatctctgttcttgccaaatggatgggcaagactacagaa
tgggaacccttcttcgctgaggctagcagaagaggctacaacatgcttcattgggcgcct
cttcaacagaagggtgtgtctggcagtccctactctattcagaatcaattagtctttgat
gcagacctcttgaaggacccaaaggcaaaggatggtggagtgaaggagattgaagaagtg
ttgaagtttgcaaaggaaaagtacggtttgggaggtgtcactgacgtagtgttgaatcac
actgcatatgattctccttggttgcaggagcaccccgaagctggttactccccatacaac
actccccatcttgctcctgcgctcgaatttgaggacgctcttctgagcttgacaacaaga
ctctcgtctcttggtcttcccacaaacctcaaatccgagtctgacctccaggcgttgatc
ccccacattaaatcttccatcgacgatgccaaactctgggagtactacgtctttgacgtc
caaggctcggagcgtgctatcgccgattctttgctcaattccaagcctgaagcacccaag
ccttgggacggtgtttcccttcaaggcaagacactcgatgaactcgccgacattgtcaag
tcttctaacatcatcacttcttaccgcgcctactcctctcgatactgcacttctgtctct
ccagctgtggctgcaggattcatccaagctgcttatccaggtgattctgcagagaaccaa
gccagtcgatggggcaagatcctggatgtgctgaatgtgaatctttataaagagtataat
gaggatatccaaactggtatcgacggtgttgtaggaaggttgagatatactagattggag
gagggtggacctaagcttggagagcttacaaaagagcgggcaattgtggagcgctacttc
actcgaatccccaagagcgacattaccaagaaacaccccgagagtgctcttgctgtcgcc
aacaacggctggatgtgggcggctgaccctttaaacaactttgccgaatacccttctaaa
gcctatctccgccgccaagtcattgtctgggatgactgtgtcaagctccgatacggttct
caaccttccgacaacccgtggttatggcagcacatgatttcatatgccgaactcctcgct
gggatgtttgatggtttccgtttggacaactgtcactctacaccattgcccttgggaaag
gctgtcatcgacgctggtcgacgaatcaatcctaacctctacatcatggctgagctcttc
actggaagccaggaaatggacttgaagtttgtcagggagttgggtattaacagtcttgtc
agagaggcgtacaacggtaacactgtcaagaactttgcggatctcctctggaggtttggc
cttgggaagcctgtgggttctatggacgtcgcctgccttacatcctcaggagaggtccac
cttaacctttcgtcatcaaagtccagcgcgcgtccggcgcgtgtcacccctcttcaaggt
tctgtgccccatgcagtcttctatgaccttacccacgataaccagtctcccagagacaag
cgcactgccgaagatgccttgtctacaggtgcccttgtgaccttttgtgctgccgctttg
ggatccaacaaaggttttgacgacctctaccccaagctccttgatctagtgaccgataac
agaaagtatgaggtcattagtaatgagaaggagaagtctagtggtatcggtaatgtcaag
cgagtgctgaacgcccttcatgtggagatgatggagggtggctactctgaaggctacgtg
catgaggatggcgagtacctcatgatccaccgagttcaccccatcacccacaagggatac
atgctcgttgcccataccgcgtacccaggcttcaaaggtcgaggatgggttaaacccatt
agacttggtcgaacttccatctcatatatcttcggtgcctgtatcaagactcgctttgaa
gaatggaaggatgacccctctactcatcgtggtatcccctcgacccttggagagatccct
cctcctgagatcaccaaaggcactgggaatggagaagagtatcaagaggttgtcgtgcca
gaagacttcgctcccggaagcatcatggttttcgctactcagatgagcgatatttccggt
gacttggatgctttctgcaaagaaggtgccatagaagctatgagccaattggacttggtg
gacctcaacgtcatcctccacagggctgacagtgaagagcgggacgctactggcggcgat
ggtacttacactatccccaactacggccccattacgttctgcggtctagaaggctggatg
caccctttgcgagagatcacaaagaagaatgatctcggtcatcctctgtgccaacacttg
cgagaaggtacctgggcatttgactacgttgtaaacaggttgaacaagcaaactggtgat
ctccctcaccttgcggctcctgccaagtggttcgcttcccgctttgatcagatcaaggct
actgccccctctttcatgcgcccgaagtacttctccctcgtcattcacgaagcctacaag
gccgcccgccgagctgttgttgagcaatgctctgaatttgtttcttctggccattcgttc
attcacaatctcgccttgtgctccgtgcaaatgtatgggttggtgaagagtgccagcttg
gatcccggaaaacctgtgccaagtcttgccgcaggtctgccccatttctccgctggttgg
gctaggtgttggggacgagacgtcttcatctcccttcgaggtcttttccttacgaccggt
aattatccagctgctagggcccacatattgtcctttgggagcactctcaaacacggtttg
atccccaacttgcttgactcaacgcgaaatcccaggtacaactgtcgtgatggtccttgg
tggttcattcaaaacgtccaggattacacccacatggctcccaatggtttgaccatcctt
tctgacaaggtcaagcgccgattccctgcggatgacacatgggttccttggaatagtccg
agggcctacgagtacgagagcagcgttgccgaattgatccaggagatcttgcagaggcat
gccgagggtatcgaattcagggagtataatgccggacccaacctcgatatggacatgcgt
gacgaaggatttaaccaaaagatctgggttgattgggacactggaatcatcttcggtggt
aacagatacaactgcggtacctggatggacaagatgggttcgtctgaaaaggcgggtaac
aagggtcttccagctactcctcgggatggcgctcccattgaaatcaccggtctactcaag
agtgcccttacttggcttgataagttaagcaagggtggtaaattccctttcaagggcgtg
aatgcttctgtcaagggccagaagcgtctcgttacatataaagaatggtctgatctcatc
caagcctcttttgagaagcattactacgttcccagcgaccccgctgaagatgacaaatac
gtcatcaataaaggtttagtcaaccgccgcggtatctacaaagatgtgtttggaactcca
aaggatagagagtggagtgactatcagcatcgatgcaacttcactcttccgatgattgtc
gctcctgagcttttcactccttccaaagctcttgaggctttgcgtatcgcggatgccgtg
cttcgcgctcctttaggcatgaagaccctcgacccttcagacagccaatatcgaggcgac
tatgaaaattcgaacgacagtacagatcaagccattgccaagggctggaactatcaccag
ggtcctgagtggggcttccctcttggctggttcctcatggcttaccttaagttcgaccgt
cttgctggtgaaggcaaatctagtcccaccaagactatgcactacatttccaatatcctt
aggaatctggcccgccacattgaaaatgacccatggagaggcctgccggagctaaccaat
agcaatggaagcttctgctatgattcctgtaatactcaggcatggagcgcaagtacgatc
ctcgacgtattggaggagatgcacaagagtgggaagaattag

DBGET integrated database retrieval system