KEGG   Cryptococcus gattii: CGB_J2300WHelp
Entry
CGB_J2300W        CDS       T02232                                 

Definition
calcium-dependent protein serine/threonine phosphatase
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cgi  Cryptococcus gattii
Brite
Protein phosphatases and associated proteins [BR:cgi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CGB_J2300W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
J:join(440839..440890,440984..441134,441195..441280,441335..441429,441484..441539,441593..441652,441715..441742)
Genome map
AA seq 175 aa AA seqDB search
MGAAESSMFNSLERNSNFSGQELMRLKKRFMKLDKDGSGSIDKDEFLQIPQIANNPLAHR
MIAIFDEDGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVYDMDRDGYISNGELYLVLK
QMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMVASTDIVKQMTLEDLF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgctgaatcgtccatgttcaattccctggaaaggaattccaacttctcaggg
caggagcttatgagattgaagaagaggtttatgaaacttgacaaggacggttccggatct
atcgacaaggacgagtttctccagattccccaaatcgcgaataaccctttggcgcatcga
atgatagcaatctttgatgaagatggaagtggaacggttgattttcaagaatttgtcgga
ggtttgagtgctttcagtagtaaaggagggcgtgatgaaaagctgagattcgctttcaag
gtctacgacatggaccgagacggctacatctccaacggtgaactatatcttgtgttgaaa
caaatggtcggaaataatcttaaagatcaacagttgcaacaaattgtagataaaaccatc
atggaggctgataaggacggggatgggaagctctcttttgaggagttcacacagatggta
gctagcacagacattgtcaagcaaatgacccttgaagatcttttctag

DBGET integrated database retrieval system