KEGG   Cryptococcus gattii: CGB_K1580WHelp
Entry
CGB_K1580W        CDS       T02232                                 

Definition
protein-lysine N-methyltransferase
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cgi  Cryptococcus gattii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CGB_K1580W
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CGB_K1580W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:join(360967..361603,361649..361733,361780..361862,361916..362498,362548..362788,362836..362970,363037..363201)
Genome map
AA seq 642 aa AA seqDB search
MFSFFGEESKLPASTVMVGSIAVKKQAPTRQQSSGSIAGPSKSSNVTPRHSHDSLKGASR
SASAKSISKQGPSPSSNSTAKVKQDGRIKPPATPRTPASSSSPGRMKRKTPNVQVVESES
SSGSESSDDALDPKSKRPKVTRKETGIDMPPLPGEEVVGRRVFCWDKVDMRGEWGRGWAG
FVGCDEVVRGNVQGWANGGGGDGSKNLGKYRAFFPQEGFDRDGDFLPSVEVLYPAKGCRE
KFVLMVPSSDREFNPIGELRNTLRLILEHYIPPSHRHIFGTLAESLDISNPLSALPSRMT
TPLPNLLVTPPPDPASPSPAFETSATSTPAPSSERQETISDMIRKSLAPNRRDGPLFVTA
IERYNSAMQAIQEDGTLQQWLDEGMNGGKEIKVREWAALVDFVHDQAYSRVVGGYSHELE
HHPKHPEEVSKAISGKEDAYGELRHAFMTKIIEQTKLGPDSVFVDLGSGVGNCILQASLQ
AGCRSYGFELLPVPAHCARLQVREVQRRWAMWALKGNLDVQVHEGDFRVHKEVGRRLREA
DVVLVNNEVFPSSLNMDLADMFLDLKEGAKIVSLKPFVPEGFRMNESNCDSFAAILRSTQ
HDYYRDWVSWKGEWGNYYVAVIDRSRRIKFEESMMGRASRRR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtttttcggcgaagagtccaagttaccagcttcgaccgtcatggtcggcagc
attgccgtcaaaaagcaagctccgacccgccagcagtcttcaggatctatagctgggccg
tcaaaatcctcgaatgtaactcccagacactcgcatgattctctcaaaggggcgtcgagg
tcagcatcagcaaaaagcatatcgaaacaaggaccaagcccttcctcaaacagtaccgcg
aaagtgaagcaagatgggcgtatcaagcccccggccacacctcgcactcctgcatcgtca
tctagtcctggaaggatgaagcgaaaaaccccgaacgtccaagtggtcgagtctgagtcc
tcaagtggatcggaatcaagcgacgatgctcttgatcctaaatccaagcgaccgaaagtt
acccgaaaagagactggaattgacatgccgcctctacctggagaagaagttgtgggccga
agggtattttgttgggataaggtggatatgcgaggtgaatggggaaggggctgggcaggg
tttgtgggatgtgatgaggtcgttagagggaacgtgcaaggatgggcgaacggaggaggt
ggggatggaagcaagaatttggggaaatatagagcgttctttccccaagagggctttgat
agagatggggactttctaccgtcagtggaagtgctttaccccgccaaaggttgccgagaa
aaatttgttcttatggtgccctcatcggacagggagtttaatcccattggtgaacttcga
aatactttaagattaatactggaacactacatacctccatcccatcgtcatatattcgga
actctggccgagtcactggacatttccaacccactctcggctttgccatcacgtatgacg
acccctcttcctaacttactcgtgacaccaccgcccgatcctgcttctccttcgccggct
tttgaaacttccgccacttctactcctgcaccatcctccgaaagacaagaaactatctca
gacatgatacggaaatcccttgcgcctaaccgtcgagatggtcctctattcgtgaccgcc
attgaacggtacaattcggctatgcaagctatacaagaggatgggacattgcaacaatgg
ttagatgagggtatgaatggtggaaaagaaatcaaagtcagagaatgggctgcattagtt
gactttgtgcatgatcaagcctactccagggttgtaggtggatatagccatgagttggag
catcatcccaagcatcccgaagaggtatcaaaggccatcagcgggaaggaagatgcttat
ggagaattgaggcatgcgtttatgaccaagatcatagaacaaacgaagcttggacctgat
tctgtctttgtcgatctcggtagtggtgtcggcaattgcatacttcaagcatcccttcaa
gcaggttgcagaagctatggttttgaactcttacccgttcccgctcactgtgctcgtcta
caagtgcgagaggtacagaggagatgggctatgtgggcattgaaaggaaatttggacgtg
caggtgcacgagggagactttagggtccacaaggaggttggtcgacgactgagggaagct
gatgttgtactggtgaataacgaagtgtttccgtcatcattgaatatggaccttgcggat
atgttcctcgatttgaaggaaggtgcaaagattgtcagtctcaaaccctttgtgccagaa
ggtttcagaatgaatgaaagtaactgcgactctttcgctgctatccttcgatctacccag
cacgactactaccgagactgggtctcatggaaaggcgaatggggcaactattatgtggct
gtcattgatcgatcgagaaggatcaagtttgaagagagtatgatgggaagggcatccaga
agacgttga

DBGET integrated database retrieval system