KEGG   Cryptococcus gattii: CGB_K3180CHelp
Entry
CGB_K3180C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_K3180C
Enzymes [BR:cgi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CGB_K3180C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(join(679129..679227,679286..679352,679408..679494,679552..679964,680017..680043,680103..680193,680244..680263,680326..680373))
Genome map
AA seq 283 aa AA seqDB search
MGISQNEKSVILTHESGTSVEIYFYGATVVSWKQGGKERMFVSSKSAMDGSKAIRGGIPV
VFPIFGPPPPSPPEYASLSQHGFARTSIWKFDSVVMDRPEGVSVRFVLPSAPPTFPHQFK
LSYVVTLAPHQLSTDLHVINSGKEKFSFQALLHNYLAVPDSSKIKITGIDKGTTYKDKVL
GGKIDEWDGSTLVIDRELDRVYQKVPSREITVDDGAGSGYKVRFRGFEDCTIWNPQEATG
SKMADMEDKGWEKYVCIEPGYVREFKTLSPSEELILAQTITVL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggtatctcacaaaacgaaaagagcgtcatacttactcacgagtcggggacttccgtt
gaaatttacttctacggtgctactgtagtgtcttggaaacaaggcggcaaggaacgcatg
ttcgtgagctccaaatcggccatggacggttccaaggcgatccgaggcggtatccctgtt
gtcttccccatctttggccctcctcctccttctccccctgagtacgcttccctcagccaa
cacggttttgcccgaaccagcatttggaagtttgactctgtcgtgatggaccgtcccgaa
ggtgtctctgtccgatttgttttgccttctgcccctccaaccttcccccaccaattcaag
cttagctacgttgtcactctcgccccgcatcaactttctaccgacttgcatgtgatcaac
tctggtaaagagaaatttagcttccaggctttgttgcacaactacttggctgtccccgac
tccagcaagattaaaatcactggaattgacaagggtaccacttataaagacaaggttttg
ggaggaaagattgatgaatgggatggcagcacccttgtcatcgatcgagagcttgacagg
gtctaccagaaagtgccctctcgtgaaatcactgtggacgatggtgccggatctggttac
aaggtccgattccgaggctttgaggactgtactatctggaaccctcaagaagcgacgggt
agcaagatggccgatatggaggacaaaggctgggagaagtacgtctgtattgagcctggc
tacgtcagggaattcaagaccttatctccctctgaagagcttattttggctcagaccatc
accgtgctttag

DBGET integrated database retrieval system