KEGG   Cryptococcus gattii: CGB_K3300CHelp
Entry
CGB_K3300C        CDS       T02232                                 

Definition
pol II transcription elongation factor
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CGB_K3300C
Transfer RNA biogenesis [BR:cgi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CGB_K3300C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(join(707489..707577,707634..707775,707849..708529,708587..708725,708777..708890,708940..709049,709097..709160,709213..709547))
Genome map
AA seq 557 aa AA seqDB search
MIAPTTSQSELHLLCVSAVVRDLISTYNSSSSSATQPPNVNSLRAKYAKKYGLKAVPRLT
DVLAAVPEEWKDRLRGWLRAKPVRTASGVAVVAVMCKPHRCPHVAMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVNQLRDLGHSVDKVEIIIMGGTFMSMP
EDYRHKFIAGLHNALSGHTGDDVDEAVKFSEQSKIKCVGITIETRPDYCLKPHLSQMLRY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHMSKDAGYKIVAHMMPDLPNCGTERDI
WQFQEFFENPAFRSDGLKLYPTLVIRGTGLYELWRTGKYKNYPPNALVDIVARIMALVPP
WTRVYRVQRDIPMPLVSSGVENGNLRELALARMKDFGAECRDVRYREVGLHEIHHRVRPQ
DIELIRRDYAANGGWETFLSYEDPQSDILVGLLRLRKCSEEGTFRKELVGMEGGCSLVRE
LHVYGTAAPVHSRDPKKFQHQGIGTLLMEEAERIAREEHGSGRIAVISGVGTRDYYRRLG
YFLDGPYMVKDLLYDDE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacccacaacctcacagtcggaactgcaccttctctgtgtatccgccgtggtc
agagaccttatctcaacctacaactcctcaagcagctccgccacccagcctcccaacgta
aacagcctcagggccaaatacgcaaagaaatacggactcaaggcagtccctcgtttgaca
gatgtcctcgctgctgttccggaggaatggaaggataggctgaggggatggctgagagca
aagccggtcagaacggcgagcggtgtggctgttgtcgctgtcatgtgtaaaccccatcga
tgtcctcacgtcgccatgaccggaaacatctgcgtttactgccccggcggtcctgattct
gactttgaatactcgacccagtcatacactggctacgagcctacttctatgcgagccatc
cgagccaggtatgacccatatgagcaggcgcgtggacgtgtgaaccagctacgcgacctt
ggacacagtgttgacaaggttgagatcattatcatgggaggaacgttcatgtcgatgccg
gaagactaccgccacaaattcattgcggggcttcacaatgccttgagcggtcacactgga
gacgacgtcgacgaggctgtcaagttctccgagcaaagcaagatcaagtgtgttggtatc
accatcgaaactcgtcccgattactgcttgaagcctcatttgagtcagatgttgaggtat
ggatgcacccgtttggaaattggtgttcagtcagtttatgaggacgttgcacgagacacc
aaccgagggcacactgtccgagctgttagtgaatccttccacatgtccaaagacgccggg
tacaagattgtcgcccacatgatgcctgatcttcccaactgcggcaccgagcgggacatt
tggcaattccaagaattctttgaaaatcctgctttccgatcagacggtctcaagctgtat
ccaaccttggttatccgtggtaccggtctttacgaactctggagaactggcaagtacaag
aattaccctcccaacgcccttgtcgatatcgtagccaggatcatggcgctcgtacctccc
tggacacgagtctaccgtgtccaacgagatatccctatgcccctcgtctcttccggtgtg
gagaatggtaatttgcgtgaactcgcgcttgcgcgtatgaaggattttggtgccgagtgt
cgagatgtgcgataccgtgaagtcggtctgcacgaaattcaccatcgtgtgcgacctcag
gatatcgagcttatccgaagggattacgcggcgaacggtggatgggagactttcttgtcg
tatgaggatcctcagtctgatattttggtcggtcttttgaggttgagaaagtgttcggag
gaagggacgtttaggaaggagttggtcggtatggaaggtggatgcagtcttgtgcgagag
cttcacgtgtatggtactgccgcacccgtccactctcgtgaccccaagaaattccagcat
caaggtatcggtacattgttgatggaagaggcggagcgtatcgctcgtgaggaacacggt
agcggtcgtatcgctgtaatctctggtgttggaactcgtgattattatcgacgacttggt
tacttccttgatggtccttatatggtcaaggatcttttgtacgatgacgagtag

DBGET integrated database retrieval system