KEGG   Cryptococcus gattii: CGB_K4390WHelp
Entry
CGB_K4390W        CDS       T02232                                 

Definition
ubiquitin-specific protease
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_K4390W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_K4390W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:join(963867..965903,966027..966133,966222..966384,966492..967107,967190..967536)
Genome map
AA seq 1089 aa AA seqDB search
MASPYPDNGSPVPSIPFPSIHNPNPYTQPYPYNAAGAYYRQSQPYYPNPPPIPYPSYAPI
PMGGAGPGPATMQNGYGGYGEYGVYYGYTGYPDYQGPQAGYQGGEGDDYSDPSKTPGSTH
AVPQPPMNMVGPNHNPHLGMPQQFPSYPPNHPYAFGGGVGYPQGYNRPPQHMHQHQHHPQ
PQHPQSHFHPQHQQHLQQQGPYGGYGYQEGYHGGKLNPAAQGFKYNRYQQQQQQQQQLQQ
AQAHAQAQAQAHAQTQAQAQLAQAPPRQPVHTQPPQPPPVPAPAPIAPSHNQPSEPLQPP
IPNGHSHPEPSIPSIALAEEKESQSTKEQKPVSAPVAVKEEEKETMDDEASFHDASSAIA
APRWNFVHPSSLSSSSAGIATSSLKMNNHAHVQRIRLVKSRPAEESDGNSYAMEVKAGLP
QEIVVDEQSPSPSQTQTRSQRKGEGRGEGPRKGRKEEKGTSKRVWKTGEKRRVELVFGEV
VPEQDKEEEEKAELVAEKPVVDGTKEEKLEKKEVSTPTRAPAQTQTQAPAPAASPAPAKP
RSWAALLKTPTHSSPSTPGAVPSSSASVSSTTEAGPSRPRPSTSTSPSTPNLTPTVNGVA
QPQPSPQAQGGQPQQQAKTFNYAAAAMSSVPSPHEDLVRLLSEGVSSIRGPVGLTAKEKE
ALMVPRGLINTGNMCFANTILQVLVYCPPFTELFEEFGKRLKADLARKTPLLEAMIIFLR
EFVSSPESSTSTTSTPKGKGKDKDSRKEAFIPENVYDAMKENKRFDSMRRGYQEDAEEYL
GFFLNTLHEEIIYLLSRTSTTSSSIPNGQSSDPSSRKIERPISPGAGANGNADSSSGWLE
VGKKQKTHVVRATESRESSVSRLFGGKLRSILHTPGQKDSVTIEPYQPLQLDITGATILS
ITDALRAISTPEIIHGVYSAAKGGEVDATKTVYVETWPKVLICHLKRFVYDTEEGGVVKR
SKAVAYGVDLMIPNEIISPARRTSSPIKYALFGVVYHHGSSASGGHYTVSVARPSLSSSA
SSTPAGTSISTSSSSTTMATRWLHFDDENVREVREEDVVVSLDQAKGGESGLVGGRERCA
YLLFYRRVQ
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccatacccggacaacggttcgcctgtgccttctatccccttcccgagcatc
cacaatcccaatccctatacgcagccatacccatacaatgctgccggcgcatactaccgc
cagtcccagccttactaccccaatccgcccccaataccctacccctcgtatgcccctata
cccatgggcggcgccggaccaggaccggcgacgatgcagaacggctacggaggctatggc
gaatacggagtgtactatggctacactgggtatccagactaccaggggcctcaagcaggc
taccagggcggggaaggagacgactacagtgacccttcaaaaacaccgggctcaacacac
gccgtaccccaaccgcctatgaacatggtcgggccaaaccacaatccccatctcggtatg
cctcaacagttcccctcttatccgccgaatcatccatatgcgtttggcggtggtgtcggc
tatcctcaagggtacaatcggccgccccaacatatgcaccaacaccaacatcatccccaa
cctcagcatccgcaatcgcacttccacccgcaacatcagcaacatttgcagcagcaagga
ccgtatggagggtatgggtatcaggaggggtatcatggagggaaattgaatcctgcagcg
caggggttcaagtataatcggtatcaacaacaacaacagcagcagcagcagctacaacaa
gcacaagcacatgcacaagcgcaagcgcaggcacatgcacaaacgcaagctcaggctcaa
cttgctcaagcgccaccacgacaacctgtacatactcaaccccctcaaccccctcctgta
cctgcacctgcaccgatcgctcctagtcataatcaaccatccgaaccattacaaccccct
atccctaacggtcattcccaccccgaaccttccatcccttccatagccctcgcggaagag
aaagaatcacagtctacaaaagagcaaaaacctgtgtctgcacctgtggcagtcaaggaa
gaagaaaaggaaacaatggatgacgaagcatcttttcacgacgcgtcatcggcgatcgcc
gcacctcgatggaactttgttcacccgtcatctctgtcatcatcatcggctggtattgcc
acttcaagcctgaaaatgaacaaccatgcccatgtccagaggataaggctggtgaaaagt
cgaccggcagaggagagtgatgggaatagttatgcgatggaggtgaaggctggtttacca
caggagattgtcgttgatgagcaatcgccatctccatctcagacgcagactcggtcgcaa
aggaagggagaaggacgtggggaggggccaagaaagggtagaaaggaggagaagggaacg
agtaaaagagtatggaagacgggtgagaagaggagagtagagttagtttttggtgaagtt
gtccccgagcaagacaaggaagaggaggagaaggccgagttggtggcagagaagcctgtg
gtcgatggcacgaaggaagaaaaactggagaagaaggaagtatctacacctactcgtgca
ccagcacaaacacaaacacaagcaccagcaccagccgcctcccccgcccctgccaaaccc
cgttcatgggctgccctcctcaaaacccctactcactcttccccctcaactcccggcgcc
gtgcccagctcttccgccagcgtctcttccaccaccgaggctggaccttctcgtccacga
ccatccacttccacttccccttctaccccgaaccttacccccacagtcaacggtgtcgcc
caacctcagccttcaccccaagcccaaggcggacaaccacagcaacaagccaaaacattc
aactatgctgccgccgcaatgtcatccgtaccttctccgcatgaggatttggtcaggctt
ttgagcgagggtgtgagctctattcgtgggccagtagggttgactgcaaaggagaaggaa
gcgttgatggtgccgaggggattgatcaatacggggaacatgtgctttgccaacactatt
cttcaagtattggtttactgtccaccgtttaccgagctgtttgaggaatttggaaagcgc
ctgaaagctgatttggcgaggaagactccgttattggaggcgatgatcatcttcttgcga
gagtttgtctcatcacccgaatcatcgacgtcaacaacatcaaccccgaagggtaaagga
aaagacaaggattcgaggaaagaggcgtttattccagagaatgtgtatgatgctatgaag
gagaacaagaggtttgattctatgcgtagaggttaccaagaagatgctgaagagtacctt
ggatttttcctcaacacattacacgaagaaatcatctacctcctttcacgaacatccacc
acctcttcatccatccctaacggtcaatccagcgacccatccagccgaaaaatcgaacgg
cctatttctccgggcgccggcgccaacggcaatgccgattcatcctctggctggctcgaa
gttggcaagaaacaaaaaacccacgtcgtgcgcgctaccgaatcccgcgaatcttccgtc
tcccgcttatttggtggtaaactccgttccatcctccacactcccggccaaaaggatagc
gtcacgatcgaaccttaccaacctctccaacttgacattaccggcgctactatcttgtcc
atcaccgacgccctccgtgcgatctccacgcctgagataatacatggtgtgtattcggcg
gctaaaggtggggaagtggatgcgaccaagacggtgtatgtggagacttggccaaaggtt
ttgatttgtcatctgaagaggttcgtgtatgatacagaggaaggcggtgtggtgaagaga
agtaaggcggtagcgtacggtgtagatttgatgattcctaacgaaataatatccccggca
aggcgaacgtcgtcccctataaaatacgctctcttcggtgtagtgtatcatcacggttct
tctgcttcaggaggacattacaccgtttccgttgcccgcccctctctttccagctccgca
tcttccacccccgcgggaacatcgatatcaacgtcatcatcatcaacaacaatggcaacc
agatggcttcactttgacgatgaaaatgtacgcgaggtacgagaagaagatgtggttgtc
tctctggaccaagccaagggtggagagagcgggttggtcggtgggagggagaggtgtgcg
tacttgctgttctataggagagtgcagtaa

DBGET integrated database retrieval system