KEGG   Cryptococcus gattii: CGB_L0270CHelp
Entry
CGB_L0270C        CDS       T02232                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgi  Cryptococcus gattii
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGB_L0270C
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CGB_L0270C
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CGB_L0270C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CGB_L0270C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(85026..85095,85145..85747,85798..86038,86092..86171,86219..86313,86362..86457,86501..86611,86681..86871,86925..86967,87030..87035))
Genome map
AA seq 511 aa AA seqDB search
MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVKLRTQGHRVVLVSSGAI
GVGLRRMDLKERGKGLHQKQALAAVGQGRLIALWDNLFSQLDQPIAQILLTRMDISERTR
YLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLSAISSAICHADYLFLLTDVDC
LYTDNPRNNPDAKPVRVVRDIEKVKQQVSTSTLGTSLGTGGMSTKLIAAELATAAGTTTV
VMHSANVTDIFKIIENGPSPCREIAETPELFEGPLCTRFLRRESALKDRKWWIAHGLHAA
GTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPFASHQAVRLIVRRRRQDDVAALDSVDE
STPGSPTPDLSQIPQPVTLASPALRHLTIGTTNPITIMSDINNTEPDTPQLQPSMSLSSS
IASLDPLSRSVPPSPAITALAERLGTASLTSIGRGLAESESDEWEEVEVAKGLARYNSVE
IDRIKGRKSSEIEKFIGYVESEHVVDSITFL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtaaatcaaaattcacccctctgaccatcgttatcaaactcggtacttcctct
attgtatcgccaacatacccttttgttccacatcttcgacttctttcatctatcgttgag
actgtagtgaagctccggacgcaaggacatcgtgtcgtcctggtatcttcgggtgctatc
ggtgtgggattgaggaggatggatctcaaggaaagagggaagggattacatcagaagcag
gctcttgctgctgttggtcaaggacggttaattgcgctgtgggataacctgttctctcaa
ttggaccaacctattgcccaaattcttctcacccgaatggacatttcagaaagaacgcgt
tatctcaacgctcaaaacactttctccgaattactgcaaatgggcgttattcctatcgtc
aatgagaatgacacggtctcggtctctgaaatcaaatttggcgacaatgacacattatcg
gcgatctcttctgccatctgccatgccgactatctcttccttttgacagacgttgactgt
ttatacacagacaatccccgtaataatcccgatgcgaagcctgtgagagtcgtacgcgac
attgagaaggtgaaacagcaagtgtctacctcgaccctcggaacatctctcggcacagga
ggcatgtccacaaagctcattgctgccgagcttgctacggctgctggcacaaccaccgtc
gttatgcattcagccaacgtcactgacattttcaaaatcattgaaaacggtccgtcacct
tgccgggagatagcagagactcccgaattgtttgagggcccgctgtgtacgagatttttg
agacgagagtcagctcttaaagaccgaaaatggtggatcgctcacggtcttcacgctgct
ggtactgttgtcatcgacgaaggtgcctgccgtgccatccgacgcaaagaatccggtggc
cgacttcttcctgctggtgtcgtccgcgtcgtcggccctttcgcaagtcaccaagccgtc
cgtctcattgttcgccgtcgacgccaagacgacgtcgctgcccttgattcagtcgacgaa
tcaacccctggtagccccacccccgacctctcccaaataccccagccggtgacactcgct
tctcctgctcttcgacaccttacaattggaaccaccaatcctattaccatcatgtctgac
atcaacaacactgaacctgatactcctcaactccaaccttccatgtctctttcatcatcg
atcgcttccctcgacccattaagccgaagcgtgccccctagccccgcgataacggctttg
gcagagaggttaggcacagcatccttaacgagtattgggcgggggttggctgaaagtgag
agcgatgagtgggaagaggtcgaagtggcaaagggtctggctcggtacaacagtgtagag
attgataggattaagggacgaaagagttcggaaatcgaaaaatttattggatacgtcgaa
agcgagcatgtggtggactcgattacgttcttgtag

DBGET integrated database retrieval system