KEGG   Cryptococcus gattii: CGB_L0290CHelp
Entry
CGB_L0290C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgi  Cryptococcus gattii
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CGB_L0290C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CGB_L0290C
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CGB_L0290C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(93230..93376,93547..93774,93832..94002,94061..94346,94390..94403,94454..94641,94689..94756,94803..94813,94859..94997,95055..95223,95268..95283))
Genome map
AA seq 478 aa AA seqDB search
MPELPEVERARKLIEDSCKGYKIASVDAQEDRIIFTGGTDHNEFAKEISGRTITGCERKG
KMFWITLSGEGRYPVMHFGMTGMIQLKGQEPTWYRRRPKESVDVWPPRFYKFVLRLEPQK
GSIGDEPRELAFIDGRRLGRLRLVSDPVSSYPPVSELGFDPVLSHPTLEEFTKLLVNKKG
TVKGVIMDQAFSAGVGNWVADEVLYQARIHPSCPIPALSEQNIKDLHHQLRAVPLTAISV
NADSKLFPSDWLFRWRWSKGTTQKKQMEKDKKTKGKKFIDGEGGEDVEPEDKEFLELPDG
SPATIKFIEVGGRTTALVEELQKMPEGVKVKSKIKKGGKVAGAKRKKPTKEEESDEDSEL
SDQSKPEEKEPERSFTARQRATAEKKGVNNDSAWQTKNEDTKSSAAERRTARATTGKSKH
HQDSQVKKEEPRISKKQLEAVDEKPRKVKPQRGRKKVASTPESSELSDVPEYFEDTKT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctcccagaagttgaaagagctcggaaactcattgaagactcctgcaagggg
tacaagatcgcttcagtcgatgcacaagaagaccgtatcatcttcacaggtggcacagat
cataacgagttcgccaaagagatatcaggaagaactataacaggatgtgagcggaaaggc
aaaatgttctggataactttgtcgggtgaagggcgatacccggtaatgcattttggcatg
acaggtatgatacagcttaaaggtcaagaaccaacttggtatcgaaggaggcccaaagag
agtgtggatgtttggcctcccagattttataagtttgtactgagacttgaacctcaaaaa
ggctccatcggtgatgaacctcgagaactggccttcatagatgggcgccgacttggtcgt
cttcgcctggtatctgatccggtatcttcttatcctcccgtctcagaattaggtttcgat
cctgtactcagccacccaactttagaagaatttacgaagctgctggtgaacaagaaaggt
actgtgaaaggtgtcatcatggatcaagcattcagtgcgggtgttggtaattgggttgca
gatgaggtactttaccaggcccgtatccacccctcgtgccccattcccgcattgtctgaa
caaaacatcaaagatcttcatcatcaactccgtgctgtccctcttactgcaatatctgtc
aatgccgactcaaaacttttcccttccgactggcttttccgctggaggtggagtaaaggt
acaactcagaagaagcaaatggagaaggataaaaagaccaaaggaaagaaatttattgat
ggtgaggggggtgaggatgtggagcccgaggataaagagtttttggagcttcccgatgga
tcaccagcgacgatcaagtttattgaagtcggcggacgtacgactgcattagtcgaagaa
ctgcaaaagatgccagaaggggtcaaggtcaagtcgaaaatcaagaaaggtggcaaagtg
gcaggagcgaaaaggaagaagcccaccaaggaggaagagtcggacgaagacagtgaacta
tctgaccagagcaaaccagaagagaaggaaccagaaagatcatttactgcaagacaaaga
gcaactgcagagaaaaagggtgtaaacaacgattcagcctggcagacgaaaaatgaagat
actaagtcttctgctgcggaacgacgaacagccagggcgacgactgggaagtccaagcat
catcaggattcacaagtaaagaaggaagaacctcgtatatccaagaagcaattggaggca
gttgacgagaaacctagaaaagtcaaacctcaaaggggtagaaagaaggtagcttcaact
ccagagtcttcagaattatcggatgttcccgaatacttcgaagacacaaagacgtaa

DBGET integrated database retrieval system