KEGG   Cryptococcus gattii: CGB_L0430WHelp
Entry
CGB_L0430W        CDS       T02232                                 

Definition
histone-lysine N-methyltransferase
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cgi  Cryptococcus gattii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CGB_L0430W
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CGB_L0430W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:join(133296..137626,137679..137760,137814..137998,138066..138220,138281..138300,138513..138583,138644..138713,138794..138955)
Genome map
AA seq 1691 aa AA seqDB search
MSIADSCSSPEDQNINNLLGNHSQTIGVLPSPPLVEDRAAPNGMEVNGEDAVGQGNETNA
VQPAVHISGTPLSTSNSNRPQLVSGAQPAVASSSRSPINSPPKRTPSIPQRSPSSHAASC
RSINNESPPSRPPTPPLPPTHSTPVILSGFSASSTLSLVPAASSNISPTISSGPPEAPLS
DPNIPTVLPTTSITAALSNPSTPSTSTTPQASGAVLTSSASFSVVPISVAPATSSSANPG
LSTLQRASEATKSCNQKEASRKTKFKQSPSPSSTHGSWTHPRPFNAPSNLSATSREASAA
SSRSTSRAPLPNRPALSDTVADPTETTSVLSTGTSARTPFSSLPSQSQGQGHPRSPSLDG
VGNTEREKFKTLSSGTGQIASPRLSSLTSDVPSDRKTKSTGLHALPPKPSNIPTSSIPQR
TSTLATAMSINPFVRLPTPPPRPSSSEASRPPIQTPKGAIKTTQNQDKIHPLSTASSIPS
PPRQTTTEAATPFRITISSPSPSQSTSASTKSHVAQNAQSSATSALSDEKIHPFRRKSKA
SESVPATSQAIASLSYRARASGGAREGDKKTAETSVYAGPSSADSRASTAPSTSAIAPTV
VTLSKALLEDAPILKSGSIVHPLFHNVSANGGQDASSLKMGAVGDVWSQGSKGRASSPQI
TTTGAVSHFVPPVDVDSKTGPVAVPLLSASDAATKNVDAEAAAQPPSQVPLPSAISALSK
KNLESLSKESSIKSSPSSVSSSSTVGDSASGLRRKPHHKSTQSEPQGPLPTTNTNNNSGI
EVNSWLNPQPFGSSFAASHLSTHAKKKIKEREREKKRKREKVKEEQKAKDENEQLRQKRM
ADLEKLSANLERYKEHMAVKCQTRSILREDGESRKRPPGPETNVGTGGEMRTVKRSKPTW
AVAPEDRPVVAETEKENGKVNKKTTVAIEINNQLPAPHTPTFATSLSSVKATATPLAVTV
GLGPPVNSCSSSNTPSLLNRSINLDIPREKPKERMDDDDGDDSAGGLPVRKTGQNGAVEE
QVEQVRLDLDDVSIHSSSPVVPLSTFTSQFKNVSITPSQCQKVVKESDDDVPIQHSAGKV
NGKQKTQSSEWESDRRESEDDILNWPSRKGKGRAVPEPQDRSETQRDDDDHHHHLNLGPG
SGEEESSDEDSIPAIPPSLFEHRPAHVRQPLQTLSKGGLVAKHSYQRPLAKSSAVSPVPS
ADRTSSEPSAKVDLLPQKRKRRLKKLTREQWHHIAQNSLSDVDDLLDEPLKKPKSAEELG
ADLSKLTKPRIFPMVSHSESRSKRASAEEDNEYFTDSDSHTSDVALFVQYPDPPPPPERI
REAKREFNTRTIDPWNRQKHTFRSNPALHRAIFEAYIMQSTSMEESGGDDIKVTNDVDAA
GGPPDFEFVYSDTMLYPDGIPPPELGLGCDCDGPCDPDSKTCTCVKRQELYFYDLGLKGF
AYDENGKVRENSASIWECNELCGCPPECMNRVIQRGRARDAGIEIFKTKEKGWGIRARSF
IPSGTYIGSYTGELIREAESERRGVTYAAIGRTYVFDLDGWQIRHPPEGLEKIDKRAAEL
AEAVKMRAKAAMRESQEDAYNAYSVDAFHYGNHSCDPNLAITQAYVKDFHPERPLLVIFT
RRDIKKHEELCISYKGIPDDGDIPSPEPVKKKKGGKDKKQISKTSASAHPPEMIASDSGK
GLVEVKDICRW
NT seq 5076 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagcggattcttgctcttcaccagaagatcagaatattaacaatcttttgggg
aatcactctcaaacgataggagtcctacctagtccgcctctggtcgaggatcgtgcagca
ccgaatggaatggaagttaatggggaggacgctgttggtcagggtaatgagactaatgct
gttcaaccggcagtacacatatccgggacgcctttatcaacatcaaattcaaacagaccg
caattggtctctggggctcaacctgccgttgcttcctctagcagatctcccatcaattct
cctcctaaacgaaccccttcaatcccccaaaggtcaccttcgtcccatgcggcatcttgc
agatctatcaataatgagtctcccccttcaaggcccccaactcctccattaccaccaaca
cattcgacaccagtaattctatcagggttttcagcgtcctcaacgctttcccttgtaccg
gctgcctcatcgaacatctcgcctaccatatcttcaggacccccagaggctccactttcc
gatcctaatatacccacagtacttccaactacttcaattacagcagcactttcaaatccc
tcaacaccttctacatctactacacctcaggcttctggagctgttttaacttcttcagca
tccttctctgtggttcctatatctgttgcacccgctacatcttcctcagccaatcccgga
ctatcaactcttcaacgcgcttcagaagctaccaaatcatgtaaccagaaagaagcgtca
agaaaaacgaagttcaaacaatcgccttccccttccagtacccacggttcgtggacgcat
ccacggccattcaacgctccttctaacctgtcggctacgtcaagggaagcttcagcagct
tcgtcgagatctacgtctcgggcaccgttacctaatcgtccggctttgagtgacactgtc
gctgatcccacagaaacaacttctgttttatcaaccggtacatcagctagaaccccattt
tcatccttaccatcacaatcacaagggcaaggtcacccaaggtcgccatcattagatggc
gtaggaaatacggagagagagaaattcaaaacgctttcttcaggcactggccaaattgca
tccccaagactttcatcactaacttccgatgtgccctcagatcggaaaactaaatcgact
ggtctccacgcgctaccaccaaaaccctccaatataccgacctcaagtatcccgcagaga
actagtacactggctacggctatgtctataaatccatttgttcgattgccaacccctcct
ccccgcccatcgtcgtctgaagcttcccggccgcctatccagactcccaaaggagcgata
aaaaccacacaaaatcaagataaaatacatccgttatcgacggcatcgtctataccttcc
cctcctaggcaaacaacgacagaggccgccacacccttccgcatcacgatttcatcacca
tcaccttcccaatctacttctgcatcgacaaaatcgcacgtggcgcaaaatgcgcaaagt
tcagcaacatcagcgctttctgatgaaaagatacatccttttagaagaaaaagtaaggct
agcgagtctgttccagcaacttcccaggctatagcttcgttgtcttatcgggcaagggca
tcaggaggagctcgcgagggcgataaaaagactgcggaaacttctgtttacgcaggacca
tcctctgctgattctagagcgtccacagcgccttctacaagcgctattgcacccacagtt
gtgacactctcgaaagctctactagaagatgctcctattttaaagtctggttctatagtt
catccgctctttcacaatgtgtctgcaaatggaggtcaggatgcctcttcactcaagatg
ggagcagttggtgatgtatggtcacaaggatcaaagggccgggcatcgtcgccgcagata
acaaccactggagcagtctcgcactttgtgccacctgtcgatgtagattcaaaaactgga
ccggtagcagtgccattactctcagcatcagatgcggctaccaaaaatgtcgatgctgag
gctgctgctcagccgccaagccaggtaccccttccatcagctatatctgctttgtcgaag
aagaacctagagtcattgtccaaagagtcgagcatcaaatcttccccatcatctgtctct
agttcaagcaccgtgggcgattcggcttccggactcagaagaaaaccgcatcacaaatca
actcaatcggagccgcaaggtccgctccctacaactaataccaataataatagtggtata
gaagttaattcttggcttaacccgcaaccttttgggtcttcattcgccgcttcacatttg
agtacacatgccaagaaaaaaataaaagaaagggagagagagaagaagaggaagagggaa
aaggtgaaagaggagcaaaaggcgaaagacgagaatgagcaattaaggcaaaaacgaatg
gcagatttagagaagttgtcggcaaatctggaaaggtataaagaacatatggccgtcaaa
tgtcaaacccgctcgattcttcgtgaggatggcgaaagtagaaagaggccaccaggtcca
gaaaccaatgtcggcactggtggggagatgaggactgtgaaaaggagtaaaccgacatgg
gctgtcgcacctgaagatcgacctgtcgttgctgaaaccgagaaggaaaatggaaaagtc
aataagaaaacaacagtagccatcgaaatcaacaatcaattgccagcgcctcatactccc
acatttgctacctccctttcatctgttaaggcaaccgccactcctttagctgttactgtc
ggtttgggaccaccagtcaactcttgcagctcgtctaatacgccttcattgcttaatcgt
tctatcaatctagacataccgagggagaaaccgaaagagcgtatggacgatgacgacgga
gatgattcggcaggtgggttgccagtcagaaaaaccggacaaaacggtgctgtcgaggag
caagtggaacaagtccgtctggatttggatgatgtctctatacactctagttctccggtt
gtgcctctttctactttcacttcacagtttaagaatgtgtctatcacaccctctcagtgt
caaaaggtagtaaaggagtcagatgacgatgtacctatccaacattcagctgggaaggta
aatgggaagcagaagacacaaagtagcgagtgggaaagtgatagacgggagagtgaggat
gacattctcaactggccttcaaggaaaggaaaggggagagccgttcctgaacctcaagat
cgttcagaaacacagagagatgatgacgatcatcatcatcatctgaatttggggccaggc
agtggagaggaggagtccagtgacgaggattctattcctgctataccgccttccctattt
gaacatcgcccggcgcatgtgcgacagcctttgcagactctttccaaaggcggacttgtc
gcgaaacatagttaccagcgccctcttgccaaatcttctgctgtttcccctgttcctagt
gccgatcgcacttcctctgagccctccgccaaagtcgatctgttgccccaaaagcgcaaa
cgtaggctcaagaagcttaccagagagcagtggcaccacatcgcacagaactctttgtca
gatgttgatgacctgcttgatgaacctttaaagaagccgaaaagtgcagaggagcttggt
gccgatctttccaaacttacaaaacctcgtattttccccatggtttctcactcagaatct
cggtcaaagagagcatctgctgaagaagataacgaatactttacggactctgactcacat
acatctgacgtcgccttgtttgtccaatatcctgacccccctcctcctcccgagcgcatc
cgcgaagccaaacgcgagttcaatacgcgtactatcgatccatggaataggcagaagcat
acttttcgatccaacccggctttgcatcgtgctatctttgaggcatatattatgcagtct
acgtcaatggaagagtcgggtggggatgatatcaaggtaacgaatgacgtcgacgctgct
ggtggtccgccggactttgagtttgtgtattcagatacaatgttatatccagacggtata
ccgccaccagagttaggtttggggtgcgattgtgatggaccttgcgatccggactctaaa
acttgcacttgtgtaaagaggcaagagctttatttttatgatttgggcttgaaaggtttc
gcatatgatgaaaacggtaaagtcagagagaactccgcttccatttgggagtgtaacgag
ctttgtggatgtcctccggagtgtatgaatcgcgtcatccaacgaggccgtgccagggat
gccggaatagagatttttaagacgaaagaaaaaggttggggcattcgcgcccggtcattc
atacccagtggaacatacattggcagctacaccggagagttgattagggaggcggaaagt
gaacggcgaggagttacctacgccgccattggtcgaacatatgtctttgaccttgacgga
tggcaaattcggcatccacccgaggggctggaaaagattgataaacgcgcagcagagttg
gctgaagcggtgaaaatgagagccaaggctgcaatgcgagagagccaagaagatgcttat
aatgcatatagtgtggatgcttttcattatgggaatcactcgtgcgatcccaatttagcg
attacccaagcatatgtcaaggactttcatccagagcgaccattacttgtgatctttact
cgtcgagacattaagaagcacgaagaactttgtatcagttacaagggtatacccgacgac
ggcgacattccatccccagaacctgtgaaaaagaagaaggggggtaaagacaagaaacag
atatccaagacatctgcttctgcacatccaccagagatgatagcttcagattctggcaag
ggcttggtggaggtgaaggatatctgtcgatggtaa

DBGET integrated database retrieval system