KEGG   Cryptococcus gattii: CGB_L0490CHelp
Entry
CGB_L0490C        CDS       T02232                                 

Definition
endoglucanase E-4 precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cgi  Cryptococcus gattii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_L0490C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CGB_L0490C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(152861..153091,153157..153575,153620..154230,154281..154345,154393..154512,154564..154887))
Genome map
AA seq 589 aa AA seqDB search
MFVPLLALASLSRLVTAQLTPSPTYSPPTSSAGLTASSETPNAQWSNIIGNSLWFYDAQR
SGRLNEGAYGNRVDWRNDSGLEDGSDWGLDLVGGWYDAGDYIKATFPMSFTLFALSWGAL
THGHGYSLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQVGSDSVDNNYWGGDQNIPNPR
LGYPINSSYPGTDGWAAASAAFSLGSLLYTTGVSYTPTSSSSPPTSPSLENSTYASQLLA
HAESLYSVANSTNPRQTYYTALGEAVAAYPSSDWEDNLCISALALALATNNSAYYADAYN
YYVQYGLTSTQEVWNWDSSEPAIYVMFAEVASAKPQLAQGAGLDANLTGWRTEVENYFDG
LINENFKNSYLTKGGLLYWNGDSDEASLNPAMAVAMLMFKYAPMASSTDKTNSYNSFAQS
QLNYMLGSNPMSVPYLVGQHPNSPSNPHSAPASGGSDMNNIRDDPPTEAHVLYGAMVGGP
LSSDLFWDWRDDWVQTEVALDYNAMIPTLASMQLLNNTADPPYVNIAAGTYSIPSGQPCD
AALPCGGRGLSGGAIAGIVVGVIVGVALLVIVAVWWWWRRKGNRWGKKW
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccccctccttgccctcgcttctctatcccggctcgtcacagctcagctcacc
ccatcccctacttattctcctcccacctcctctgcaggactcacagcctccagcgaaaca
cccaacgcacaatggtccaacatcattggtaactctctttggttctacgatgcccaaagg
tcaggtagattaaatgaaggggcgtacggcaatagagtagattggaggaatgacagcggc
ttagaggatggaagtgattggggcctggatcttgtcggtggttggtatgatgcgggtgac
tacatcaaggcaacgttccctatgagtttcacattgtttgcgctatcctggggagcgttg
acgcacggccatggatatagccttgcgaaccaaacagcctatcttgatgggacattgaga
tggggttttgattggctcatgaaggcacatccatcggatgacgtgttgtttatccaagtt
ggctctgacagtgtcgacaacaactactgggggggggaccagaatattccaaatcctcgg
ctaggataccccatcaactcttcttaccccggtacagacggttgggccgctgcgtctgct
gccttttcactgggttccctcctctacacaaccggggtctcttacacacctacgtcatca
tcatctcctccaacctcaccctcattggaaaactccacttatgcgtctcagctattggcg
cacgccgagtcactctattctgtcgccaattctaccaaccctcgacaaacatattacaca
gctttgggcgaagcagttgccgcttacccttcttctgattgggaagataacctctgtata
tcggctctcgctctggcgttggcgacaaataattctgcgtactatgccgacgcatacaac
tattatgttcaatatggattgacaagcacacaggaagtttggaactgggattcatcggag
ccggcaatttatgttatgtttgcagaagttgcaagcgcaaagccccagttggcgcaagga
gctggactagacgcaaacttgaccggatggcggactgaagtcgagaactacttcgatggg
cttatcaatgagaatttcaagaattcttacttgaccaaagggggattactctactggaac
ggcgactctgacgaggcgtctttgaaccctgccatggctgtcgctatgctcatgttcaaa
tatgcacctatggcgtcgtcaaccgataagaccaactcttacaattcatttgctcaatcc
caactcaactacatgctcggctccaatcccatgtcagtcccttacctcgttggacaacac
cccaattccccatccaacccccactctgctcccgcctctggtggttccgacatgaataac
attcgtgatgacccccctacggaggcgcatgtgctctacggtgcgatggttggtggaccg
ttgagcagcgatctgttctgggactggagagatgattgggtgcagacagaggtagcgctg
gattataatgcgatgatcccaactcttgcctctatgcagctcttgaataacactgcggat
ccaccttatgtaaacatcgctgcaggcacatactccatcccctctggtcaaccttgtgat
gctgctcttccatgcggtggccgcggtcttagtggcggtgcgattgcaggaattgttgtg
ggtgttattgtgggtgtggccttgttggtgattgtagctgtttggtggtggtggaggagg
aagggaaatagatggggtaaaaagtggtag

DBGET integrated database retrieval system