KEGG   Cryptococcus gattii: CGB_L0620CHelp
Entry
CGB_L0620C        CDS       T02232                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cgi  Cryptococcus gattii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CGB_L0620C
Enzymes [BR:cgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CGB_L0620C
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C44
   CGB_L0620C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(191786..192044,192110..192482,192544..193369,193429..193580,193810..193978))
Genome map
AA seq 592 aa AA seqDB search
MCGIFCCFNRAGDISQYRARAIACSKRQRHRGPDWSGCYMTDNTVLVHERLAIVGVDTGA
QPLTNEDESLVLAVNGEIYNHVALRKGLKNKDAVFKTHSDCEVIMHLYREHDTGLCNMLD
GMFSFVLVDKSVSPPRLIAARDPIGITTLYMGWNSQSPDNLYFASELKCIHEECDNLQAF
PPGHFYDSKEKKLTRYFNPSWWDSDKGVVPHNDVDYKLLRESLEAAVRKRLMSEVPYGVL
LSGGLDSSLIASIAARETDKLAEEQEKLRQERKQAIASGKWVGDEQPLASWPQLHSFAIG
LPGAPDLIAARKAADFLGTIHHEYTFTVQEGLDAIPEVIYHLETYDVTTVRASTPMYLLS
RKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPNAKDFHEECVKRVKNLHTADCLRANKSTM
AWGLEARVPFLDKSFLEVSMNIDAKYKMFSKGTHQEVDEDGRPKMEKYILRKAFDCSPDG
KAYLPDSILWRQKEQFSDGVGYSWIDGMKDHAAAIVSDEKFADRATRWPLDTPDTKEAYW
IREIFEHHFPTEAAAKTAVRWVPKQEWGVSSDPSGRAVSIHTAAYEDGKAKA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcttctgctgcttcaaccgtgcgggagacatctctcaataccgagcccga
gccatcgcctgctccaagaggcagcgacaccgtggccccgactggtctggttgttacatg
accgacaacaccgttcttgttcacgagcgattagctattgttggtgttgacaccggtgct
caaccccttaccaatgaagacgaaagtctcgtccttgccgttaacggtgaaatctacaac
catgtcgctctcagaaagggtctcaagaacaaggatgccgtattcaagacccactccgac
tgtgaagtcatcatgcacctctacagggagcacgacactggtctctgcaacatgctcgat
ggcatgttctcctttgtccttgttgacaagtccgtttcccctcctcgattgattgccgcc
cgtgaccctatcggtatcaccactctctacatgggctggaactctcagtctcccgacaat
ctttactttgcttctgagctcaagtgcatccacgaagagtgtgacaacctccaggctttc
cctcccggacatttctacgactccaaggagaagaaactcactcgatacttcaacccctca
tggtgggactctgacaagggtgtcgtccctcacaacgacgttgactacaagcttttgagg
gaatctcttgaagctgcagtcaggaagaggttgatgtccgaagttccttatggtgtcctc
ctctcaggtggtcttgactccagtttgattgcttccatcgccgctagagaaacagacaag
ctcgctgaggagcaagaaaaattgagacaagaacgaaaacaggctattgcgtctggcaag
tgggtcggtgacgagcagccactcgcttcttggcctcaactccattcttttgctatcggt
ctccccggtgctcccgatcttattgcagcccgaaaggcggccgacttcctcggtaccatt
caccacgaatacaccttcaccgttcaggaaggtcttgatgccatccccgaagtcatctac
caccttgagacttatgatgtcaccactgtccgagctagtacccctatgtacctcctcagt
aggaagatcaaggctatgggtgtgaagatggtcttgtctggagagggtagtgacgaaata
tttggtggttacctttacttccacgccgctcccaacgccaaggacttccacgaagaatgc
gtcaagcgagtgaagaacctccatactgccgactgtctccgtgccaacaagtccaccatg
gcttggggtctcgaagcccgtgtgcccttccttgacaagtctttcctcgaagtctctatg
aacatcgatgccaaatacaaaatgttctccaagggcactcaccaagaggttgacgaagat
ggtcgacccaagatggagaagtacatcttgagaaaggcgtttgactgctctcctgacgga
aaggcttacttgcctgactccatcctctggaggcaaaaggaacaattctctgacggtgtt
ggttactcttggattgacggcatgaaggaccacgctgccgccatcgtctccgacgagaag
tttgccgaccgggccacccgatggcctctcgacactcctgacactaaggaggcttactgg
attcgtgagatatttgaacaccacttccctaccgaagcggctgccaagaccgctgttcga
tgggtccccaagcaggagtggggtgtgtcttctgacccctccggtagggctgtgtctatc
cacactgcggcgtatgaggacggtaaggccaaggcttag

DBGET integrated database retrieval system