KEGG   Cryptococcus gattii: CGB_L1290CHelp
Entry
CGB_L1290C        CDS       T02232                                 

Definition
cytochrome-b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cgi  Cryptococcus gattii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_L1290C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CGB_L1290C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(281734..282026,282079..282310,282367..282433,282480..282668,282727..282820,282886..282925,282983..283014,283083..283140,283214..283267))
Genome map
AA seq 352 aa AA seqDB search
MAAARFLSSARIARPSIVSRTAAQSRGYSSAAPSGGANWPLLLSVAGVTGIGAYAYLQYN
PSVKKEVEAKIKGAEAEKAAAERTAAGVSAFVKDTWIPFTLEKIEKYNHNANIYHFSFGE
EGKDKISGGEVASVVLLRSPEGPDQIKDEKGKPIIRPYTPISPPDQKGSVELMIKKYSTG
KFTPYLADLTPGQQVLFKGPLQKFKYEPNSFEKGLCIAGGSGITPMWQLINHSLSIPEDK
TKWTLIYANVSEADILLRKEFDALAQKYPGRLDIKYVLDKGPWGWKGETGYVTADLIKKT
FPKNEDENVRAFVCGPPGQMKAISGEKDGMKQGELSGALKDLGYTSNEVFKY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctaggttcctctcttctgctaggatcgcccgtccttccatcgtctccagg
actgccgctcagtcccgaggctattcgtccgctgctccttccggcggcgccaactggccc
ttgctcttgtccgttgccggtgttaccggtatcggtgcatacgcatatctccagtacaac
ccttctgtcaagaaggaggtcgaggccaagatcaagggcgctgaggctgaaaaggccgct
gctgagcgtaccgctgccggtgtcagtgcttttgtcaaggacacttggatcccctttacc
ctcgagaagattgaaaaatacaaccacaacgccaacatctaccacttcagctttggagag
gagggtaaagacaagatctctggcggtgaggtcgccagcgtcgtccttttgagatcccct
gagggtcccgaccaaatcaaggacgagaagggcaagcctatcatcaggccttacaccccc
atctcaccccctgaccagaagggctccgtcgagttaatgatcaagaaatactccaccggc
aaattcactccttaccttgccgatctcactcctggtcagcaggtcctcttcaagggcccc
ctccaaaagttcaagtacgagcccaacagtttcgagaagggcctctgcattgctggtggt
tctggcatcacccccatgtggcagctcatcaaccactccttgagcatccccgaggacaag
accaaatggactcttatctacgccaacgtctctgaggccgacatcttgttgaggaaggag
tttgatgctcttgcccaaaagtaccctggccgtcttgatatcaagtacgttcttgacaag
ggaccttggggctggaagggtgagactggctatgtcaccgccgatctcatcaagaagaca
ttccccaagaacgaggatgagaatgtccgtgcctttgtttgtggtcctcctggccagatg
aaggccatttcgggtgagaaggacggtatgaagcagggtgagctctctggcgccctcaag
gatctgggttacacttccaatgaggtcttcaagtactaa

DBGET integrated database retrieval system