KEGG   Cryptococcus gattii: CGB_L3530CHelp
Entry
CGB_L3530C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
cgi  Cryptococcus gattii
Pathway
cgi00230  Purine metabolism
cgi00240  Pyrimidine metabolism
cgi01100  Metabolic pathways
cgi03030  DNA replication
cgi03410  Base excision repair
cgi03420  Nucleotide excision repair
cgi03430  Mismatch repair
cgi03440  Homologous recombination
Module
cgi_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGB_L3530C
   00240 Pyrimidine metabolism
    CGB_L3530C
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CGB_L3530C
   03410 Base excision repair
    CGB_L3530C
   03420 Nucleotide excision repair
    CGB_L3530C
   03430 Mismatch repair
    CGB_L3530C
   03440 Homologous recombination
    CGB_L3530C
DNA replication proteins [BR:cgi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CGB_L3530C
DNA repair and recombination proteins [BR:cgi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CGB_L3530C
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     CGB_L3530C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 10185835
NCBI-ProteinID: XP_003197140
UniProt: E6RED6
Position
L:complement(join(754245..754322,754375..754484,754590..754625,754695..755013,755083..755157))
Genome map
AA seq 205 aa AA seqDB search
MPPRKGSSTTVKSSGKTKRLAGLSQPTLGFQSQRKHSGTISKSKPSLQRQTSTISEVNTE
REEQGDGDIELLARPHARDQPTHKGEDESTESNVLPEQTTKDGELRQLKVKTKEWAQALK
AAKEAMGNLEPIHAGPDTHNDVHHILRVFDMTAKYGPCVGISRLDRWKRAQKLGLEPPEE
ICMILTTQQGQEDPSYRENVLNGWL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccacctagaaaaggatcgtcaaccactgtcaaatcctctggaaagacaaagagatta
gccggcctttctcaacctacgctcggtttccaatcccaacggaaacattcagggacgatt
agcaagtccaaaccctcattacagcgccagacgtcgactatctcagaagtaaatactgag
cgggaggaacaaggtgatggcgacattgaactgctcgcgcgtccccacgcaagagaccag
ccaacgcacaagggggaggatgagtctactgaaagtaatgtgctaccggaacaaacgaca
aaagatggagaactcagacagctaaaagtgaagactaaagaatgggcccaagctttgaag
gctgccaaagaagctatgggaaatcttgagcccattcatgcaggtcccgatactcataat
gatgtgcaccatattcttcgagtctttgatatgaccgcgaaatatggcccttgcgtcggt
atcagtcgtctagataggtggaaacgagcgcaaaaactgggtcttgaaccgcctgaagaa
atttgcatgatattaacaactcagcaagggcaagaagatccatcatatcgtgagaatgtg
ttgaatggatggttgtaa

DBGET integrated database retrieval system