KEGG   Cryptococcus gattii: CGB_L3530CHelp
Entry
CGB_L3530C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cgi  Cryptococcus gattii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGB_L3530C
   00240 Pyrimidine metabolism
    CGB_L3530C
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CGB_L3530C
   03410 Base excision repair
    CGB_L3530C
   03420 Nucleotide excision repair
    CGB_L3530C
   03430 Mismatch repair
    CGB_L3530C
   03440 Homologous recombination
    CGB_L3530C
DNA repair and recombination proteins [BR:cgi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CGB_L3530C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(754245..754322,754375..754484,754590..754625,754695..755013,755083..755157))
Genome map
AA seq 205 aa AA seqDB search
MPPRKGSSTTVKSSGKTKRLAGLSQPTLGFQSQRKHSGTISKSKPSLQRQTSTISEVNTE
REEQGDGDIELLARPHARDQPTHKGEDESTESNVLPEQTTKDGELRQLKVKTKEWAQALK
AAKEAMGNLEPIHAGPDTHNDVHHILRVFDMTAKYGPCVGISRLDRWKRAQKLGLEPPEE
ICMILTTQQGQEDPSYRENVLNGWL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccacctagaaaaggatcgtcaaccactgtcaaatcctctggaaagacaaagagatta
gccggcctttctcaacctacgctcggtttccaatcccaacggaaacattcagggacgatt
agcaagtccaaaccctcattacagcgccagacgtcgactatctcagaagtaaatactgag
cgggaggaacaaggtgatggcgacattgaactgctcgcgcgtccccacgcaagagaccag
ccaacgcacaagggggaggatgagtctactgaaagtaatgtgctaccggaacaaacgaca
aaagatggagaactcagacagctaaaagtgaagactaaagaatgggcccaagctttgaag
gctgccaaagaagctatgggaaatcttgagcccattcatgcaggtcccgatactcataat
gatgtgcaccatattcttcgagtctttgatatgaccgcgaaatatggcccttgcgtcggt
atcagtcgtctagataggtggaaacgagcgcaaaaactgggtcttgaaccgcctgaagaa
atttgcatgatattaacaactcagcaagggcaagaagatccatcatatcgtgagaatgtg
ttgaatggatggttgtaa

DBGET integrated database retrieval system