KEGG   Cryptococcus gattii: CGB_L3600CHelp
Entry
CGB_L3600C        CDS       T02232                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_L3600C
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_L3600C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(join(770285..770394,770486..770615,770679..770996,771051..771311,771366..771528,771583..771692,771746..771928,771992..772083,772142..772474,772526..773137,773187..773511,773564..773672,773721..773913,773978..774147,774200..774341,774420..774507,774595..774597))
Genome map
AA seq 1113 aa AA seqDB search
MQQPVNDVQDIILDESPAPMEVDDIPNVHDYEAYAAKCMPDLGLEIEDFQYQTWRIEHWS
QQPKRIVGPEFSCGGHKWRILLFPQGNANGQPNDMVSVYLDYANPKTAPEGWHACAQFCL
AISNPWDPTIQTSSHAHHRFVAEECDWGFTRFVDLRKLYTADPANGKNRPTIENDEVEIT
AFVRVLKDPTGVLWHNFVNYDSKKETGHVGLKNQGATCYMNSLLQSLFCTNYFRKAVYQI
PTEDDIPSESLALALQRVFYHLQTSNQPVGTTELTKSFGWKSLDSFMQHDVQEFSRILQD
KLEIKMKGTPAEGAIPKLFKGQMKNYIKCIDVDFESSVIEDFYDIQLTIKGLKDLRASFK
EYVSVETLDGENKYQAEGHGLQAARKGVIFKSFPPVLHLQLRRFEYDVEKDALVKINDRH
EFPFEIDLGEFLDESADRSQSHVYKLHGVLVHSGDLHGGHYFALIKPEKDGRWYKFDDDR
VTPVTDKEVLEDNYGGDMLNGLVPPHQRTQARTLKKFTNAYMLVYVRETELDTVLAPFTE
SDTPPHLKARLDHEREQLEAKKREKDEQHLYLTAKVITDEIFSKHQGFDLASFEDKNIPA
TDLPTFRVLKNESYPTFKSRIASHFKIPERDFRLWVLVNRQNKTTRPDVPIHENDNTQTM
ESIRNSMAARASDLKLYLDYNPDHAKFDELHAEGKEAPIMIFLKWFDCSRQTLLGQGKVF
VDKYQKVSDLLGIIQERMGWPSSTPIKLYEEIKAGMIEGMKLKQSFIQNEIQDGDIICYQ
VELPEKEIADLEAQSLYSSVPQFYDFLQNRILVHFKPRYEDRAASVPEFDLMLSKKMTYD
VMAHRVGEFLKHDPLKLRFTSAHNQNGAPKAIVKRSLNQSVADITQTSYYNQHAHICIYY
ELLDISIIELETKKSLKVVWTGRHNKEEATHSFLLPKTCTFNDVADNMSKLVKLEPNGSG
KIRIFDVSPSGRSQREHTGSEMIGNLPESAELFAEEIPVEELQAGEGTKIVNVFHYARDP
SRTHGVPCKFVLHEGEPFSETKARLQERIGVSEKEFAKYKFSLVTSTVFKQPSIVEENDI
IYDHKWAPDDALGLDHIDRRPNKANIEKGIVMR
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacctgtaaatgacgtgcaggacattattttagacgaaagtccggctccaatg
gaagtcgatgacatcccaaatgttcatgactatgaagcgtatgctgccaagtgcatgcct
gatctaggcttagagatcgaagacttccagtaccaaacatggcgaattgagcactggagt
cagcagccgaaaagaatagtcggaccagagttcagttgcggtggtcacaagtggcgcatt
ttgttgttcccgcaaggaaacgcgaacggacagcccaatgacatggtctcggtctactta
gattatgcgaacccaaagacagcccccgaaggatggcatgcgtgtgcacaattctgcctg
gccatttcgaacccatgggatcccacgattcaaacatctagccacgcgcatcaccgattt
gttgctgaagaatgtgattggggattcactcgatttgtcgatttgcgaaagttgtacaca
gcggatcctgccaacggcaagaacagaccgacgattgagaatgatgaagtggagattaca
gctttcgtgcgagtgttgaaggatccgacaggcgttttgtggcacaattttgtaaattac
gattcgaagaaggagactggtcatgttggtttgaaaaaccaaggcgcaacctgttacatg
aactctctcttgcagtcattgttctgtaccaattacttccgaaaggctgtctaccaaata
cccaccgaagacgacattccatccgaaagcttggctttggctcttcaacgtgtattttat
catcttcagacgtccaaccaacctgtaggaaccactgagctcacaaaatcttttgggtgg
aaatccctcgactcgttcatgcaacatgatgtccaggagttcagccgtatccttcaagac
aagttagaaatcaagatgaagggaactcctgccgaaggcgccattccgaagctgtttaag
ggtcagatgaagaactacatcaagtgcatcgacgtagattttgagtcttccgtgattgaa
gatttttatgatatccaacttaccattaagggattgaaggatttgcgggcttcctttaag
gagtatgtgtctgttgagacgctcgatggagagaacaagtatcaagcggaggggcacggc
ttgcaggctgcgagaaagggtgtcattttcaaatcattccctccagtgcttcatctccag
ctacgccgttttgaatatgacgtggagaaggatgccttggtcaagattaatgaccgtcac
gagttccctttcgagattgatttgggagagttcctcgatgagtcggccgaccggtctcag
tcccacgtctacaagctccacggtgtcctggtgcactccggcgatcttcacggtggccat
tatttcgccctcatcaagcccgaaaaggatggtcgttggtacaaatttgatgatgacaga
gtgacgcccgtcacagacaaggaggtcttggaggacaattatggcggagatatgttgaac
ggtcttgttcctcctcatcaaaggactcaggctagaacgctcaaaaagttcaccaacgcc
tatatgttggtttatgtaagggaaacagagcttgacacagtgttggctccctttacggaa
agtgacacacctcctcatctgaaggctcgcttggatcacgagagggagcagctcgaggct
aagaagagggagaaggatgaacagcacctgtacttgactgcgaaagtcatcactgacgaa
atcttctccaagcatcaaggcttcgatcttgcctcctttgaggacaagaacatcccagct
accgatctgcctactttccgggtgttgaagaacgagagttatccaactttcaagagcagg
attgcttcccactttaagattccggaacgcgatttccgtttgtgggtacttgtaaaccga
caaaacaagacaacgcgacccgatgtccctattcacgagaatgacaacacgcaaacaatg
gaaagtatccgtaattcaatggccgctcgagcttctgatctcaaattatatctcgactac
aatcccgatcatgccaagttcgacgaactgcatgctgagggcaaggaggctcctatcatg
atcttcctcaagtggtttgactgttctcgtcagacgttattaggccaaggaaaggtcttt
gtcgacaagtaccaaaaagtctcggacttgttgggtatcatacaggaaaggatgggttgg
ccatcttcaacgcccatcaagctctacgaggaaatcaaagcggggatgattgagggaatg
aaattgaagcagtccttcattcaaaatgaaatccaggacggagatatcatctgttatcag
gtggaacttcccgagaaagaaatcgccgatctagaagcacaatcactatactctagcgtt
ccccaattctacgactttctccagaaccgaattcttgtccatttcaagcctcgttatgaa
gatagagccgccagcgtgcccgaatttgatctcatgctgagtaagaagatgacgtatgac
gttatggcgcatcgagttggggagttcctcaaacacgaccctttgaagttgagattcacc
tcagctcataaccaaaacggtgcccccaaagctatcgtcaaacgttcgttgaatcaaagt
gtggcggatattacccagaccagctattacaaccagcatgctcacatctgcatctattac
gagttacttgatatcagtatcatcgagttagaaacgaaaaaatcactgaaggttgtttgg
acaggaagacacaataaagaagaagccacgcattcatttttactgcccaaaacctgcaca
ttcaatgacgtggccgataacatgtcaaagctcgtcaaactcgaacctaatggcagcggc
aaaattagaatctttgatgtctcaccctccggtcgatcacaacgtgaacatactggttca
gaaatgattgggaatctccctgaatcagctgaattatttgcagaagagattcccgttgaa
gaattacaagcgggcgagggcaccaagattgtgaacgtgttccactacgccagagaccct
tccaggacccatggcgttccctgcaaatttgttctgcacgaaggagagcccttctctgag
accaaagcacgattgcaagagaggatcggtgtttctgaaaaggaattcgccaaatacaag
ttctctttagtgacctcaacagtattcaagcaaccctctattgtggaagaaaacgacatt
atctacgaccataaatgggcgccagacgatgctcttggtcttgaccatatcgataggcgg
ccaaacaaggcgaacatcgaaaagggtattgtgatgagatag

DBGET integrated database retrieval system