KEGG   Cryptococcus gattii: CGB_L3620WHelp
Entry
CGB_L3620W        CDS       T02232                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cgi  Cryptococcus gattii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cgi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cgi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cgi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:join(778610..778872,778937..779022,779079..779142,779195..779266,779321..779671,779738..779851,779922..780363,780444..780668)
Genome map
AA seq 538 aa AA seqDB search
MSLPQGIYLTAPIPKGGEHILSTQALEFLAVLHRTFNKRRLELLKNREKVQAELDQGKSL
SFLPETREIRENLAWSCAPPGPGLEDRRVEITGPTDRKMVVNALNSGAKTFMADFEDSNS
PTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLLVRPRGWHLPEPRLIIDGTPM
SGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEARLWNDAFSLATSHLGVQQGVIR
ATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYIFSFIKKQRAHKNCVFPDRSDVTMT
VPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKNDPAANERAMSKVRADKLREVTAGHDG
TWVAHPALIPIALEIFNQHMPGPNQYHVRREDVTVTDKQIADPSVPGKITEQGLRDNVSA
ALSYCAAWISGNGCVPINHLMEDAATAEIARVQLWQWCKYGSKTDSGKDINPSYVQTILS
EEASKVSKLPGIDPSHVKIASEYMAQQVKADWPSDFLTSDLLGYLEGVGTKGGAKASL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctccctcaaggtatctacctcactgcccctatccccaagggcggtgagcacatc
ctctctacccaagccctcgagttcctcgccgtgctccatagaacattcaacaagcgaaga
ttggaactgttaaaaaaccgtgaaaaggttcaggccgagctggatcaaggcaagtccctc
tcgttcctcccagaaaccagggagattagagagaaccttgcttggagttgtgcccctccc
ggtccagggcttgaagaccgtcgagttgagattaccggcccgaccgacaggaagatggtc
gtcaacgctttgaactctggtgctaagacctttatggccgattttgaggactctaactct
cctacctggtcaaatatggttctgggacaggtcaatctttacgatgcaatccgacgacaa
attgactttgaaatcaacggcaaggcttacaaactctccgagaagcctgctgtgcttttg
gtccgaccccgagggtggcaccttcctgaaccccgtttgattatcgacggcactcccatg
tccggctccctcttcgactttggtctttactttttccacaacgcccgcgaactcatctcc
cgaggttctgggccttatttttacctccctaagatggaacatcatctcgaagctcgtctt
tggaacgatgccttctcccttgcgacaagtcacttgggggtgcagcagggtgtgattagg
gcgacagtattgattgagactttgcccgcggcattccagatggaagagattctgtatgag
ttgaaggaacattctgccggtttgaactgtggacgatgggattacatcttcagtttcatc
aagaagcaacgagctcacaagaactgcgtcttccccgatcgatctgacgttaccatgact
gtccccttcatggacgcttacgtccgcctactcatccaaacttgtcataagcgaaaagta
gccgctatgggaggcatgtctgcccagattcctatcaagaacgatcccgccgccaacgaa
cgcgccatgtcgaaagttcgcgccgacaaactccgtgaagtcaccgccgggcatgacggc
acatgggttgctcaccccgccctcattcccatcgccctcgagatttttaaccaacacatg
ccaggtccgaaccagtaccacgtccgccgcgaagatgttactgtcacggacaagcagatt
gccgatccttctgtccctggaaagattacagaacaagggttgagggataatgtaagcgcc
gctttgtcgtattgtgcggcatggattagtggaaatgggtgtgtgccgatcaatcacttg
atggaggatgctgcaacggcggaaattgccagagtacaactttggcagtggtgcaagtat
ggctccaagacggactccggcaaagacatcaatccctcttacgtccaaaccatcctctct
gaggaagcatccaaagtctcaaaactccccggtattgacccatctcacgtcaagattgca
tctgagtatatggctcagcaggtcaaggccgattggccgagtgatttcttgacaagtgat
ttattggggtaccttgaaggtgtcggcactaagggcggtgccaaagctagcctttaa

DBGET integrated database retrieval system