KEGG   Cryptococcus gattii: CGB_L3620WHelp
Entry
CGB_L3620W        CDS       T02232                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00620  Pyruvate metabolism
cgi00630  Glyoxylate and dicarboxylate metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01200  Carbon metabolism
Module
cgi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGB_L3620W
   00630 Glyoxylate and dicarboxylate metabolism
    CGB_L3620W
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CGB_L3620W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 10185829
NCBI-ProteinID: XP_003197121
UniProt: E6REE5
Position
L:join(778610..778872,778937..779022,779079..779142,779195..779266,779321..779671,779738..779851,779922..780363,780444..780668)
Genome map
AA seq 538 aa AA seqDB search
MSLPQGIYLTAPIPKGGEHILSTQALEFLAVLHRTFNKRRLELLKNREKVQAELDQGKSL
SFLPETREIRENLAWSCAPPGPGLEDRRVEITGPTDRKMVVNALNSGAKTFMADFEDSNS
PTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLLVRPRGWHLPEPRLIIDGTPM
SGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEARLWNDAFSLATSHLGVQQGVIR
ATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYIFSFIKKQRAHKNCVFPDRSDVTMT
VPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKNDPAANERAMSKVRADKLREVTAGHDG
TWVAHPALIPIALEIFNQHMPGPNQYHVRREDVTVTDKQIADPSVPGKITEQGLRDNVSA
ALSYCAAWISGNGCVPINHLMEDAATAEIARVQLWQWCKYGSKTDSGKDINPSYVQTILS
EEASKVSKLPGIDPSHVKIASEYMAQQVKADWPSDFLTSDLLGYLEGVGTKGGAKASL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctccctcaaggtatctacctcactgcccctatccccaagggcggtgagcacatc
ctctctacccaagccctcgagttcctcgccgtgctccatagaacattcaacaagcgaaga
ttggaactgttaaaaaaccgtgaaaaggttcaggccgagctggatcaaggcaagtccctc
tcgttcctcccagaaaccagggagattagagagaaccttgcttggagttgtgcccctccc
ggtccagggcttgaagaccgtcgagttgagattaccggcccgaccgacaggaagatggtc
gtcaacgctttgaactctggtgctaagacctttatggccgattttgaggactctaactct
cctacctggtcaaatatggttctgggacaggtcaatctttacgatgcaatccgacgacaa
attgactttgaaatcaacggcaaggcttacaaactctccgagaagcctgctgtgcttttg
gtccgaccccgagggtggcaccttcctgaaccccgtttgattatcgacggcactcccatg
tccggctccctcttcgactttggtctttactttttccacaacgcccgcgaactcatctcc
cgaggttctgggccttatttttacctccctaagatggaacatcatctcgaagctcgtctt
tggaacgatgccttctcccttgcgacaagtcacttgggggtgcagcagggtgtgattagg
gcgacagtattgattgagactttgcccgcggcattccagatggaagagattctgtatgag
ttgaaggaacattctgccggtttgaactgtggacgatgggattacatcttcagtttcatc
aagaagcaacgagctcacaagaactgcgtcttccccgatcgatctgacgttaccatgact
gtccccttcatggacgcttacgtccgcctactcatccaaacttgtcataagcgaaaagta
gccgctatgggaggcatgtctgcccagattcctatcaagaacgatcccgccgccaacgaa
cgcgccatgtcgaaagttcgcgccgacaaactccgtgaagtcaccgccgggcatgacggc
acatgggttgctcaccccgccctcattcccatcgccctcgagatttttaaccaacacatg
ccaggtccgaaccagtaccacgtccgccgcgaagatgttactgtcacggacaagcagatt
gccgatccttctgtccctggaaagattacagaacaagggttgagggataatgtaagcgcc
gctttgtcgtattgtgcggcatggattagtggaaatgggtgtgtgccgatcaatcacttg
atggaggatgctgcaacggcggaaattgccagagtacaactttggcagtggtgcaagtat
ggctccaagacggactccggcaaagacatcaatccctcttacgtccaaaccatcctctct
gaggaagcatccaaagtctcaaaactccccggtattgacccatctcacgtcaagattgca
tctgagtatatggctcagcaggtcaaggccgattggccgagtgatttcttgacaagtgat
ttattggggtaccttgaaggtgtcggcactaagggcggtgccaaagctagcctttaa

DBGET integrated database retrieval system