KEGG   Cryptococcus gattii: CGB_M0230CHelp
Entry
CGB_M0230C        CDS       T02232                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_M0230C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CGB_M0230C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 10185876
NCBI-ProteinID: XP_003197222
UniProt: E6REZ8
Position
M:complement(join(54963..55038,55128..55291,55361..55419,55476..55621,55673..55767,55822..55978,56040..56124,56200..56302))
Genome map
AA seq 294 aa AA seqDB search
MSTIEVLTQKLAPHAGFLGGLVVAAILGLVILFQEKDRKVLDPVEWRSFKLVDKDHLSHN
TALYRFALPRASDSLGLPIGQHISVAAEINGKQVVRSYTPTTLDDEKGHFDLVVKTYEKG
NISRYLSLLTIGQEVKVKGPKGKFVYTPDMAPHLVMIAGGTGITPMYQIIKSSVKNPRDQ
TKLSLIYANVQEDDILLKKEIDELQAKSNGRFDVKYVLNNPPEGWTGGVGFVTKEMIEEA
MPPSGVGSPNHGEGHKVLMCGPPPMINAMKGHLAQIGYPAPRSVSKLEDQVFLF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatcgaggttctcactcagaagctggcccctcatgccggcttcctcggcggt
ctcgttgtcgctgctattctcggccttgtcatcctcttccaggagaaggacaggaaggtt
cttgaccccgtcgaatggaggtctttcaagctcgttgataaggaccacttgtcccacaac
actgctttgtaccgatttgcccttccccgtgcttccgactctctcggtctccccatcggt
caacacatctctgtcgccgcggagattaatggcaagcaggttgttaggtcttacactccc
actactttggatgacgaaaaaggacactttgacttagttgtcaagacttacgagaaaggc
aacatctcccgatacctttctcttcttacgatcggccaggaagttaaggttaagggtccc
aagggcaagtttgtgtacacccccgacatggcccctcacctcgtcatgattgccggtggt
accggtatcactcccatgtaccagattattaaatcctctgtcaagaatccccgtgaccag
accaagctctctttgatctacgccaacgtccaggaagatgacatcttgctcaagaaggag
attgacgagcttcaagccaaatccaacggccgtttcgatgttaagtacgtcctcaacaac
cctcccgagggctggactggtggtgtcggttttgtcactaaggagatgatcgaggaagct
atgcctccttctggtgttggctctcctaatcacggtgaaggtcataaggttttgatgtgc
ggtcctccccctatgattaatgctatgaaaggccacctcgcgcagatcggttaccccgct
cctaggagcgtctccaagctcgaggaccaagttttccttttctaa

DBGET integrated database retrieval system