KEGG   Cryptococcus gattii: CGB_M1070WHelp
Entry
CGB_M1070W        CDS       T02232                                 

Definition
component of the nuclear pore complex required for polyadenylated RNA export; Gle2p
Orthology
K14298  
mRNA export factor
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CGB_M1070W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:join(188462..188587,188651..188743,188798..188974,189025..189177,189232..189332,189388..189408,189460..189656,189719..189824,189881..190004)
Genome map
AA seq 365 aa AA seqDB search
MLSTFRTGVKDIELANPPTDSISSIEFSPTTDILAVASWDNNVRLYDVNSQGQNQGKAMY
SHQGPVLDLTWSADGQYVFSSGCDNAAQMYNIQTQQAQQVAQHDAPIKCIEFAEVPGSGQ
VLITAGWDKKLKYWDLRSPNPIATLDLSDRAYSMSVAQQLLVCATGDRQLHVINLSNPTT
IFKSIESPLKWQTRVVSCFPTGDAFAVGSIEGRVAIQYPGEDDKRNFSFKCHRYDIPTGS
MPRTPAVSGSQNVFAINSLTFHKVQGTFCSGGSDGSLTFWDGISRTKLKTFSCKDLNNGD
TDVRPPRFGTPIVSTSFNRTQEIIAAMSYDWSKGHSGVPPAGQSVNKVMLHPVKPEEVNK
KPKRN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaccttccgaaccggtgtcaaggatattgaactcgccaaccctcccacggac
tcaatctctagcatcgagttctctcctacaaccgatatacttgcggttgcgagctgggac
aataatgtgcggttatacgacgtgaactcgcaagggcagaaccaagggaaggcgatgtac
tctcatcagggccctgtgcttgatttgacttggtcagcagacggtcaatatgtcttctcc
tccggatgcgacaacgctgctcagatgtacaacattcaaacacagcaggcacaacaagta
gctcaacatgatgcacccataaaatgtattgaatttgcggaagtaccagggagtggacag
gttttgattacagcgggttgggataagaagctcaagtactgggatttgagatcgcccaac
cctattgcaactctcgatctgtctgatagggcctattcaatgagcgttgctcaacaactg
ttggtctgcgctacaggggaccgtcaactgcatgtcatcaatctttcaaaccctaccacc
atcttcaagagtattgagtcgccgttgaagtggcaaacgcgagttgtcagctgtttccca
accggagatgcatttgctgttggaagtattgagggacgagtagctatccaataccctggg
gaggatgataaacgaaatttttctttcaagtgtcaccgatacgacatccctactggtagc
atgccccgaactcccgccgtcagcggctcccagaatgttttcgctatcaattctctcact
tttcacaaggttcagggaacgttttgctctggtggtagcgacggtagtttgacattctgg
gacggtatctctcgaacaaagcttaagactttctcctgcaaggatctgaacaatggggac
actgatgttcgaccaccgagatttggtactcccattgtttctacatcctttaaccgaact
caagaaatcatcgctgccatgtcatatgattggtccaaggggcacagcggtgttcctcct
gcggggcagagcgtcaacaaggttatgttgcatccagtcaagcctgaggaagtcaacaag
aagcccaagcggaattaa

DBGET integrated database retrieval system