KEGG   Cryptococcus gattii: CGB_M1140WHelp
Entry
CGB_M1140W        CDS       T02232                                 

Definition
phospholipase B
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cgi  Cryptococcus gattii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGB_M1140W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CGB_M1140W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:join(210174..210347,210410..210567,210620..210794,210842..211107,211174..211365,211422..211959,212010..212411)
Genome map
AA seq 634 aa AA seqDB search
MSVITTTFALSLFAATALAIPSETPRIELQAERGLGDKSYAPWQVNCPTNVTWIRNATTG
LGSGERAYIEAREKLVQPAIEHMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMSM
MNESTEASESETGGWLEGVSYWSGLSGGSWATGTFMSNGGQLPTSLLENLWNIDSNLIFP
DDDKVSFYTELYTETNAKSDLGFPTQITDLWGLAIGSHVLPQQYQLSNNPNLTFSSLPSV
VAALGNASLPMPIIIAAEREAGELIIAENATVWEFTPYEFGSWAFGSQYKSPGAFTPIEY
LGTSVNDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTSLITAFLAELGE
DQADISRIPNTFSNYNSGENPIYNLTYITLVDAGETNQNVPLEPLLIPARAVDAIVAFDA
SYDTDYIWPNGTALRTTYERARVLAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGCNDT
TTPLIIYVPSYPWSFAANTSTYQLSYETDEANQILLNGMRSLTLNHSVPTWPTCFACALT
DRSFMYTSENRSTICQECFDTWCWAGDDNTTQPAEYEPVINSVPPWLIANNLSLGVADAP
ASNESTPGTASSGAAKIGVSVGMVALAAGLGLMF
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttatcacgaccacttttgcactctcacttttcgccgccactgccctcgcaatt
ccttccgagactccgcgaattgagcttcaggcggagagaggtttgggtgacaagtcctat
gctccttggcaagttaactgccccaccaatgttacgtggattagaaatgccactactggt
ttaggttctggcgaacgagcttacatcgaggctcgtgaaaagcttgtccaacctgcgatc
gaacatatgatggctgcgcgagggctcgaaactcctccccggacacctgtcattggtgtt
gccttagccggtggtggttaccgtgcaatgcttactgggttaggtggtatcatgagcatg
atgaatgaaagcaccgaagcgtccgaaagcgagactggtggttggcttgagggcgtaagc
tactggtctggtctgagcggtggaagttgggcaactgggactttcatgtccaatgggggt
cagttgcccactagtcttcttgaaaatctctggaacatcgattccaacctcatcttccct
gatgatgacaaggtttcattctatactgaactttacactgagaccaatgccaaatcagac
ctcggattccccactcaaattactgatctttggggtcttgccattggctcgcacgttttg
ccccagcaatatcaactctccaacaatcctaaccttactttttctagccttccctctgtt
gttgctgccttaggaaatgcaagcttgcccatgcctatcatcattgcagctgaacgagag
gctggggagcttatcattgcggaaaacgcaactgtctgggagttcactccatacgagttt
ggttcttgggcgtttggtagtcaatacaagagccccggtgctttcacccctattgaatat
ctcggtacttcagttaacgatggctcacctaacggcacttgttggaagggctttgaccaa
ttgtcttttgttatgggaacttctgcaactcttttcaacggtgccttcctcgagcttaac
ggcacagacagcggtcttcttaccagtttaatcactgccttccttgcggagttgggagag
gaccaagctgatatttcccgtattccaaatactttttccaattacaactccggggaaaac
cccatttacaacctcacttacatcacccttgtcgatgcgggagaaaccaaccagaatgtt
cccctagagcctttgctcatccccgcccgtgccgttgacgcgattgtggcgtttgacgca
tcctacgatacagattatatctggccaaatggtactgctttgaggaccacttacgagcga
gccagggttttagctgagcacgagaacaccagggtgttgatgcctgaggtccctagcatg
aatggcttcgtcaacggtggttacaactcaaggcctactttctttggctgtaacgatacc
accactcctctgattatctacgtaccatcttatccctggagctttgctgccaacacctct
acttaccaactttcgtacgagactgatgaagccaaccaaatattgctcaatgggatgcgg
tctctcactcttaaccattctgtccccacctggcccacttgctttgcttgtgctcttacc
gaccgttccttcatgtacacctcggagaaccgatccaccatttgccaagaatgcttcgac
acttggtgttgggctggtgacgacaacaccacccagcctgcagaatatgagcccgtgatc
aacagtgttcctccctggttgatcgctaacaatctgagtttgggtgtggccgatgctcct
gcgagcaacgagtctactcctggcacagcttccagtggtgcagcgaagataggagtgagc
gtgggtatggttgcgctggcagctggtttgggcttaatgttttag

DBGET integrated database retrieval system