KEGG   Cryptococcus gattii: CGB_M3470WHelp
Entry
CGB_M3470W        CDS       T02232                                 

Definition
protein disulfide-isomerase precursor
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cgi  Cryptococcus gattii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CGB_M3470W
Enzymes [BR:cgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CGB_M3470W
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CGB_M3470W
  Exosomal proteins of colorectal cancer cells
   CGB_M3470W
  Exosomal proteins of bladder cancer cells
   CGB_M3470W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:join(661842..661981,662243..662306,662360..662499,662551..662619,662668..663401,663452..663515,663565..663799)
Genome map
AA seq 481 aa AA seqDB search
MKFSSKLSLALAAALPNLVSVLASDVIDLTESTFQKEIAGEDLALVDLAPHYEEAATELK
EKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGIVSYMTKQSLPA
ISEVTPESHDEFIKSDNVVLVAYGDDAHPVPEAFKEYAKGARDSYLFGQYLSSDLPSIPE
NPSLPAIVLYKDFDEGYAVFPSGEIAQADVDELSEFVKQNSMPLFDEITPENFGSYAEQG
IPIAYLFADPNEGSAREKLVEELKPLAKELKGSVNFVYIDAIKFVDHGKSLNLPGDSWPA
FVIQDLADQTKFPLTGKAAAKTIKDFVKKYVTGEVPPSIKSESIPATQGPVYKLVADDWN
NVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYANNANIIIAQMDATENDIPPSAPF
RVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETHRKSDADVAEEEWEEEDEAPEHDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctcccttgcccttgcggccgccctccccaaccttgtgtcg
gtcctggccagcgacgtcattgatttgaccgagtctaccttccagaaggagatcgccggc
gaagacttggctttagttgaccttgctccccattacgaggaagccgctactgagctcaag
gagaagaacatcaagcttgccaaggtcgactgtaccgttgagcaaggtctttgtggtgaa
tttggtgtcaatgggtaccctaccttgaaggtgtttaggaacggttccccgaccgactat
gctggtacaaggaaggccgacggtatcgttagttacatgaccaagcaaagcctccctgcc
attagcgaggtaacgcctgagtctcatgatgaatttatcaagtctgacaatgtcgtcctc
gttgcctatggtgacgatgcccaccccgtccctgaggccttcaaggagtacgccaagggc
gcccgagactcttatctcttcggtcaatacctttccagcgaccttccttctatccctgag
aacccttctctccctgccattgtcctctacaaggactttgatgaaggttacgccgtcttc
ccctccggtgagatcgcccaggcggatgtcgacgagctcagcgagtttgtcaagcaaaac
tctatgcccctttttgacgaaattactcctgaaaactttggctcttacgccgagcagggt
attcccatcgcctatctttttgccgaccctaacgagggttctgcccgtgagaagcttgtc
gaggagctcaagcctcttgccaaagagctcaagggttctgtcaattttgtttacattgat
gctatcaagtttgttgaccacggcaagtctctcaacctccccggtgactcttggcccgcg
tttgtgatccaagaccttgccgaccagactaagttccccttgacgggcaaggccgccgct
aagactatcaaggactttgtcaagaagtatgtcaccggtgaggttcctcctagcatcaag
tctgagtctatccccgccactcaaggtcctgtttataagcttgtcgccgacgactggaac
aatgtctacggtgatgagtccaaggatgtctttgccgagttttacgctccctggtgcggc
cactgccagcgtttggcccccatctgggacactcttggtgagaaatacgccaataacgcc
aacatcatcattgctcaaatggacgctactgagaatgacattcctccttctgcccctttc
cgagtccaaggcttccccacccttaaattccgacctgctggttcttctgaattcattgac
tatactggcgacaggagtctcgacagtcttgtcgagtttgtggagacccacaggaagagc
gatgctgatgtcgctgaggaggagtgggaggaagaggatgaggctcccgagcacgatgag
ttgtag

DBGET integrated database retrieval system