KEGG   Cryptococcus gattii: CGB_M3470WHelp
Entry
CGB_M3470W        CDS       T02232                                 

Definition
protein disulfide-isomerase precursor
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cgi  Cryptococcus gattii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cgi04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:join(661842..661981,662243..662306,662360..662499,662551..662619,662668..663401,663452..663515,663565..663799)
Genome map
AA seq 481 aa AA seqDB search
MKFSSKLSLALAAALPNLVSVLASDVIDLTESTFQKEIAGEDLALVDLAPHYEEAATELK
EKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGIVSYMTKQSLPA
ISEVTPESHDEFIKSDNVVLVAYGDDAHPVPEAFKEYAKGARDSYLFGQYLSSDLPSIPE
NPSLPAIVLYKDFDEGYAVFPSGEIAQADVDELSEFVKQNSMPLFDEITPENFGSYAEQG
IPIAYLFADPNEGSAREKLVEELKPLAKELKGSVNFVYIDAIKFVDHGKSLNLPGDSWPA
FVIQDLADQTKFPLTGKAAAKTIKDFVKKYVTGEVPPSIKSESIPATQGPVYKLVADDWN
NVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYANNANIIIAQMDATENDIPPSAPF
RVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETHRKSDADVAEEEWEEEDEAPEHDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctcccttgcccttgcggccgccctccccaaccttgtgtcg
gtcctggccagcgacgtcattgatttgaccgagtctaccttccagaaggagatcgccggc
gaagacttggctttagttgaccttgctccccattacgaggaagccgctactgagctcaag
gagaagaacatcaagcttgccaaggtcgactgtaccgttgagcaaggtctttgtggtgaa
tttggtgtcaatgggtaccctaccttgaaggtgtttaggaacggttccccgaccgactat
gctggtacaaggaaggccgacggtatcgttagttacatgaccaagcaaagcctccctgcc
attagcgaggtaacgcctgagtctcatgatgaatttatcaagtctgacaatgtcgtcctc
gttgcctatggtgacgatgcccaccccgtccctgaggccttcaaggagtacgccaagggc
gcccgagactcttatctcttcggtcaatacctttccagcgaccttccttctatccctgag
aacccttctctccctgccattgtcctctacaaggactttgatgaaggttacgccgtcttc
ccctccggtgagatcgcccaggcggatgtcgacgagctcagcgagtttgtcaagcaaaac
tctatgcccctttttgacgaaattactcctgaaaactttggctcttacgccgagcagggt
attcccatcgcctatctttttgccgaccctaacgagggttctgcccgtgagaagcttgtc
gaggagctcaagcctcttgccaaagagctcaagggttctgtcaattttgtttacattgat
gctatcaagtttgttgaccacggcaagtctctcaacctccccggtgactcttggcccgcg
tttgtgatccaagaccttgccgaccagactaagttccccttgacgggcaaggccgccgct
aagactatcaaggactttgtcaagaagtatgtcaccggtgaggttcctcctagcatcaag
tctgagtctatccccgccactcaaggtcctgtttataagcttgtcgccgacgactggaac
aatgtctacggtgatgagtccaaggatgtctttgccgagttttacgctccctggtgcggc
cactgccagcgtttggcccccatctgggacactcttggtgagaaatacgccaataacgcc
aacatcatcattgctcaaatggacgctactgagaatgacattcctccttctgcccctttc
cgagtccaaggcttccccacccttaaattccgacctgctggttcttctgaattcattgac
tatactggcgacaggagtctcgacagtcttgtcgagtttgtggagacccacaggaagagc
gatgctgatgtcgctgaggaggagtgggaggaagaggatgaggctcccgagcacgatgag
ttgtag

DBGET integrated database retrieval system