KEGG   Cryptococcus gattii: CGB_N1600WHelp
Entry
CGB_N1600W        CDS       T02232                                 

Definition
subunit of TFIIH and nucleotide excision repair factor 3 complexes
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cgi  Cryptococcus gattii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CGB_N1600W
  Replication and repair
   03420 Nucleotide excision repair
    CGB_N1600W
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CGB_N1600W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
N:join(326636..326754,326835..326951,327005..327133,327185..327400,327450..327579,327618..327909,327969..328229,328288..328469)
Genome map
AA seq 481 aa AA seqDB search
MVQPSFSAPKKDVSKQASLTSALDIFLDNQHQSYFEELYRLLPPVCRQIILHALWSHHPL
RVTDVKLLLQMDVHAPLEECDEVMRPAINRKVLHPMHYKKQKMQWSLNDSFKRGLRNALT
GLGASNSFGVPFERHQATDLDLPSKDELVAYGEETFESILKYMVSSGLGTEFSGSRPQPE
VLQLLHASGLMTDPGDMSRRNPNIYRLTITSKGFQFLLEKRQTQLWEILMYYLSAKEANS
ERSSEVLSMFFSLGCMQLGQDYSASNSFPHAQEALNDLAQYGFIYKPSPDSDQFWPTHLA
TSLCSGDASAIQSQSADDKRFLILETNYKIYAYTSNELEIAILNLFVDIRIRYPNLVVGK
LDRQHVKAAMEKGISARQIIAYLSSHAHPQMYNSPPPLLHPTIVDQLHLWDRERNRLQTE
ETVMYEFFSKELFDDTVNEAKANAALQHAATSQKLLFIEPHTKPAITEFVKQRQNVLRGG
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccttccttttcagcccccaagaaggatgtttccaagcaagcatcactgacg
tctgccctcgatatatttctcgataatcagcaccagtcgtatttcgaggagctctacaga
ttactgccgccagtatgccgtcaaattatcctccatgccctgtggtcccaccatccatta
cgagtgaccgatgtcaagctgcttctccagatggatgtccacgctcctttagaagaatgt
gatgaggtcatgagaccagctataaacagaaaagtcctccatccaatgcattataagaag
cagaaaatgcagtggtccttgaatgattcgttcaagaggggcctcagaaacgccttgaca
ggattaggagcatcaaactctttcggtgtaccctttgaaagacatcaggcaactgacctt
gatcttccctctaaggatgagctagtggcatatggcgaagagacatttgagtctattctc
aaatacatggtgtcttccggtctcggcacagaattctctggatccaggccacagcccgag
gttctccagcttttacatgctagcggtctcatgacggatcctggagatatgagcaggagg
aatcctaatatatatcgactcacaatcacttccaaaggattccaatttttgctggagaaa
aggcagactcagctgtgggagatactaatgtactacttgagtgccaaagaagcaaactct
gaacggtcatccgaggtcttgtcgatgttcttctctcttgggtgtatgcaactaggacaa
gactattctgcatccaactcttttcctcacgctcaagaagctctcaacgatctcgcgcaa
tacggcttcatctacaaaccatcgcctgacagcgatcagttttggcccacccaccttgcc
acttctttgtgttccggcgacgcttccgccattcaatcgcagagtgcagacgacaagcgt
ttcctcatcttggaaaccaactacaaaatttacgcatatacttcaaacgagctcgagata
gccatccttaacctctttgtcgacattcgcattcggtaccccaacctcgttgtgggaaag
ctcgatcgtcagcacgttaaagctgccatggaaaagggtatatcagcgcggcagattatc
gcctacttgtccagtcatgctcatccacaaatgtacaactctcccccaccattactacat
cccaccattgtcgatcaacttcatttgtgggatcgagagaggaacagattacagacggaa
gagaccgttatgtacgaatttttcagcaaagaactctttgatgacactgtcaacgaagcc
aaagcgaatgccgctctacagcatgcggctacgtcccaaaagctattattcatcgagcca
cataccaagcctgcgatcacagaattcgtcaagcaaagacagaacgtccttagagggggt
tattag

DBGET integrated database retrieval system