KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0096Help
Entry
NCgl0096          CDS       T00102                                 

Gene name
Cgl0097
Definition
thiamine pyrophosphate-requiring enzyme (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl0096 (Cgl0097)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl0096 (Cgl0097)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCgl0096 (Cgl0097)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105838..106392)
Genome map
AA seq 184 aa AA seqDB search
MYSISETIARTLMPRTDHVFDLMGNGNAWFVDALERLGRGIITVRPTVETVAAADTYHRV
TRRPAVATTTYGAGFTNTMTTLADVALSRIPLLLVVGTAPSAGPRCFDIDRQGLARAVGV
ETFTVHADDVAAVTLQAWNNTPENTHVILEIPYDLAAATATDPTVTTYLLRPGFQKLPMS
PTLS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtactcaatttcagaaactatcgcccgaactcttatgccccgcaccgatcacgttttc
gacctgatgggcaacggaaacgcctggttcgtcgatgccctagaacgcctcgggcgaggc
atcatcaccgtccgccccacagttgaaaccgtggccgccgcggacacctaccaccgcgtc
acccgccgcccggcggtcgctaccaccacctatggtgctggtttcaccaacaccatgacc
acgcttgccgacgtcgccctctcccgtatcccacttcttttagttgtgggcactgccccg
agcgccgggcctcgctgtttcgacattgaccggcaaggactcgcacgtgccgtaggtgtg
gaaaccttcaccgtgcatgcagatgacgttgctgcggtaactcttcaggcttggaataat
acgccggaaaacacacacgtgatcctggaaatcccctatgacctagcagctgccacagcc
accgatccaacagtgactacatacctgctgcgccccggatttcagaaactcccgatgtca
ccgaccttgtcctag

DBGET integrated database retrieval system