KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0096Help
Entry
NCgl0096          CDS       T00102                                 

Gene name
Cgl0097
Definition
(RefSeq) thiamine pyrophosphate-requiring enzyme (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl0096 (Cgl0097)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl0096 (Cgl0097)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCgl0096 (Cgl0097)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105838..106392)
Genome map
AA seq 184 aa AA seqDB search
MYSISETIARTLMPRTDHVFDLMGNGNAWFVDALERLGRGIITVRPTVETVAAADTYHRV
TRRPAVATTTYGAGFTNTMTTLADVALSRIPLLLVVGTAPSAGPRCFDIDRQGLARAVGV
ETFTVHADDVAAVTLQAWNNTPENTHVILEIPYDLAAATATDPTVTTYLLRPGFQKLPMS
PTLS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtactcaatttcagaaactatcgcccgaactcttatgccccgcaccgatcacgttttc
gacctgatgggcaacggaaacgcctggttcgtcgatgccctagaacgcctcgggcgaggc
atcatcaccgtccgccccacagttgaaaccgtggccgccgcggacacctaccaccgcgtc
acccgccgcccggcggtcgctaccaccacctatggtgctggtttcaccaacaccatgacc
acgcttgccgacgtcgccctctcccgtatcccacttcttttagttgtgggcactgccccg
agcgccgggcctcgctgtttcgacattgaccggcaaggactcgcacgtgccgtaggtgtg
gaaaccttcaccgtgcatgcagatgacgttgctgcggtaactcttcaggcttggaataat
acgccggaaaacacacacgtgatcctggaaatcccctatgacctagcagctgccacagcc
accgatccaacagtgactacatacctgctgcgccccggatttcagaaactcccgatgtca
ccgaccttgtcctag

DBGET integrated database retrieval system