KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0258Help
Entry
NCgl0258          CDS       T00102                                 

Gene name
Cgl0262
Definition
(RefSeq) arsenite efflux pump ACR3
  KO
K03325  
arsenite transporter
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Brite
Transporters [BR:cgl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NCgl0258 (Cgl0262)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
278859..279896
Genome map
AA seq 345 aa AA seqDB search
MSFLDRWLAAWIFLAMAAGLLIGKVFPGIGALLSAVEIGGISIPIAIGLIVMMYPPLAKV
RYDKTKEISTDRALMVVSIMLNWIVGPALMFSLAWLFLPDQPELRTGLIIVGLARCIAMV
LVWSDLACGDREATAVLVAINSVFQILMFGVLGWFYLQILPSWLGLDTTSVTFSVVSIVT
SVLVFLGIPLVAGVLSRVIGEKTKGRRWYEDTFLPKISPLALIGLLYTIVLLFSLQGDEI
TAQPWTVARLALPLLMYFVGMFFISLVVSKLSGLTYERAASVSFTAAGNNFELAIAVSIG
TFGATSPQALAGTIGPLIEVPVLVGLVYVMLWLGPKIFKKENAGS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcttgaccgctggttagctgcctggattttcttggctatggctgctgggttg
ttaatcggcaaggtctttccaggaattggggcgcttttgagcgcggtggaaattggtgga
atttccattccaattgctatcggtttgatcgtcatgatgtatccacctttggccaaggtg
cgctacgacaaaactaaagaaatcagcacagaccgcgctctcatggtggtgtcgattatg
ttgaactggatcgttggaccagcacttatgtttagcctggcgtggctgtttcttccagat
caaccagagcttcgcactgggctaattatcgtgggccttgcgcgctgtatcgcgatggtt
ttggtatggagtgatctcgcttgtggtgaccgggaagcaactgctgtgctggttgcaatc
aactcggtgttccagatccttatgttcggtgtgcttggttggttttacctgcagattctt
ccctcgtggctgggattagacaccacgtcggtgactttctctgtggtatcaatcgtgact
tccgttctcgtgttcttgggcataccacttgtagctggagttttatctcgcgtcattggt
gaaaaaacaaagggacggcgctggtacgaggacacgttcctgcctaagatttcacccttg
gcgctgattggcttgctatacacaattgttctgctgttttcgttgcagggggatgaaatc
acagcgcagccttggacagtagctcgtcttgcattgccgctgctgatgtactttgtgggc
atgtttttcatttccctggtggtatccaaactgtccgggttaacttatgagcgagctgct
tccgtgtcttttactgcagcaggaaacaactttgaattagcgattgcggtatcgatcgga
acctttggtgcgacatcaccgcaggcattagctggaacgatcggccctttgattgaagtc
ccagtattagtcggattggtttatgtcatgttgtggcttggaccaaaaatctttaaaaag
gagaatgcaggatcatga

DBGET integrated database retrieval system