KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0258Help
Entry
NCgl0258          CDS       T00102                                 

Gene name
Cgl0262
Definition
arsenite efflux pump ACR3
Orthology
K03325  
arsenite transporter, ACR3 family
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278859..279896
Genome map
AA seq 345 aa AA seqDB search
MSFLDRWLAAWIFLAMAAGLLIGKVFPGIGALLSAVEIGGISIPIAIGLIVMMYPPLAKV
RYDKTKEISTDRALMVVSIMLNWIVGPALMFSLAWLFLPDQPELRTGLIIVGLARCIAMV
LVWSDLACGDREATAVLVAINSVFQILMFGVLGWFYLQILPSWLGLDTTSVTFSVVSIVT
SVLVFLGIPLVAGVLSRVIGEKTKGRRWYEDTFLPKISPLALIGLLYTIVLLFSLQGDEI
TAQPWTVARLALPLLMYFVGMFFISLVVSKLSGLTYERAASVSFTAAGNNFELAIAVSIG
TFGATSPQALAGTIGPLIEVPVLVGLVYVMLWLGPKIFKKENAGS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcttgaccgctggttagctgcctggattttcttggctatggctgctgggttg
ttaatcggcaaggtctttccaggaattggggcgcttttgagcgcggtggaaattggtgga
atttccattccaattgctatcggtttgatcgtcatgatgtatccacctttggccaaggtg
cgctacgacaaaactaaagaaatcagcacagaccgcgctctcatggtggtgtcgattatg
ttgaactggatcgttggaccagcacttatgtttagcctggcgtggctgtttcttccagat
caaccagagcttcgcactgggctaattatcgtgggccttgcgcgctgtatcgcgatggtt
ttggtatggagtgatctcgcttgtggtgaccgggaagcaactgctgtgctggttgcaatc
aactcggtgttccagatccttatgttcggtgtgcttggttggttttacctgcagattctt
ccctcgtggctgggattagacaccacgtcggtgactttctctgtggtatcaatcgtgact
tccgttctcgtgttcttgggcataccacttgtagctggagttttatctcgcgtcattggt
gaaaaaacaaagggacggcgctggtacgaggacacgttcctgcctaagatttcacccttg
gcgctgattggcttgctatacacaattgttctgctgttttcgttgcagggggatgaaatc
acagcgcagccttggacagtagctcgtcttgcattgccgctgctgatgtactttgtgggc
atgtttttcatttccctggtggtatccaaactgtccgggttaacttatgagcgagctgct
tccgtgtcttttactgcagcaggaaacaactttgaattagcgattgcggtatcgatcgga
acctttggtgcgacatcaccgcaggcattagctggaacgatcggccctttgattgaagtc
ccagtattagtcggattggtttatgtcatgttgtggcttggaccaaaaatctttaaaaag
gagaatgcaggatcatga

DBGET integrated database retrieval system