KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0414Help
Entry
NCgl0414          CDS       T00102                                 

Gene name
Cgl0429
Definition
uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCgl0414 (Cgl0429)
Enzymes [BR:cgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     NCgl0414 (Cgl0429)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NCgl0414 (Cgl0429)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452637..454433
Genome map
AA seq 598 aa AA seqDB search
MTIAHKPEMAETTGIETNQVSETIGVESLTHGNLRPVSSFEGQHEGQTEELLPGKVIFVG
AGPGNPDLLTVRAREVLGNAVRAITDEQVLSGVRAFVATEIPVPEDKLQAAEDEYERICI
EAKENGARRKPPRPAPPTAAEITEVSEATPAQIVELVQDALSYGGDVIRLVTGNPLSSDA
TLAEISAVSEAGLEFQVVPGMSLPATVPAFAGIALGSTYTETDVNGQNLDWDQLASAPQP
LVLQARVDDLSRIAQELKARNMSLETPVSVTANGTTRLQRTYDTTLGLLHKLDAELSGPL
VVTLGKGVDDRSKYSWWENRALYGWRVLVPRAREQAASMSARLSSHGAIPQEVPTISVEP
PRNPAQMERAIKGIVEGRYQWVVLTSVNAVKAVWEKITEFGLDSRSFAGVRIAAVGEKTA
AEIRALGITPELLPARTRQNAQGLVDVFPEYFEELDPVGRVLLPRADIATDVLVDGLTHL
GWEVEDVVAYRTVRAAPPSADIRDMIKTGGFDAVAFTSSSTVKNLVGIAGKPHPRTIVAC
IGPMTAATAEELGLRVDVMPEIAEVPELIDALAEHVADLRAKGELPPPRKKRRRRKAS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgcccataagcccgagatggctgaaactaccgggatcgagaccaaccaggtt
tccgaaaccatcggggttgaatcgctcacgcacggaaacttacgtcctgtttcatctttt
gagggacagcatgagggacaaacggaagagttacttccaggcaaagtcatttttgttggg
gccggtcccggtaaccctgatcttcttacagttcgtgcccgtgaagttctgggcaacgcg
gttcgtgcgattactgatgaacaagtactaagcggcgttcgagcttttgtcgccactgaa
attcctgtgccggaagataagcttcaggctgcggaagatgagtacgagcgcatctgcatt
gaagcgaaggagaacggtgcacgccgtaagcctcctcgtccagcaccaccaaccgctgca
gagatcacggaagtttctgaggcgactccagctcagattgttgagcttgtgcaggatgct
ctttcttatggtggagatgttattcgtcttgtcaccggcaacccattgagcagcgatgcc
acactggctgagatctctgcagtttccgaggctggcctggagttccaggtggttccaggt
atgtctttgcctgcaacggttcctgcatttgcgggaattgcgttgggttctacctacacc
gaaactgatgtcaacggtcaaaacttggactgggatcagttggctagcgcacctcagcct
ttggtgctgcaggcccgcgtggatgacctttcccgtattgcacaggaactaaaggcccgc
aatatgtctttggaaactcctgtttctgtcaccgctaacggcaccacccgtttgcagcgc
acctatgacaccactttaggtctgttgcacaagcttgatgctgaactaagcggacctttg
gttgttaccttgggcaagggtgtggatgatcgctccaagtactcttggtgggaaaaccgc
gctctgtacggttggcgtgtgctggtgcctcgcgctcgggagcaagcggcatccatgtcc
gcacgtctgagcagccacggcgctatcccgcaggaagtccctaccatttctgtcgaacca
ccgcgcaacccagcgcaaatggaacgcgccatcaagggcatcgtcgaaggacgctaccag
tgggttgtcctcaccagcgtcaacgcagtgaaggcagtctgggagaaaatcaccgaattc
ggcctcgattcacgttccttcgcgggcgtccgcatcgccgcagtcggtgaaaaaaccgcc
gctgagatccgcgcgctcggcatcacgccggagcttctgcctgcacgtaccaggcaaaat
gcgcaagggcttgtcgacgtgttccccgaatatttcgaagaactcgatccagtcggccgt
gtcctcttgccgcgcgcagatatcgcaaccgacgtgcttgtcgacggcctgacccacctt
ggttgggaagtcgaagacgtggtggcttaccgcaccgtccgcgcagcaccaccaagcgct
gatatccgagatatgatcaagaccggcggatttgatgcagttgccttcacctcttcgtcg
accgtgaagaacctcgttggtatcgcgggtaaaccacacccacgcaccatcgtcgcgtgc
atcggacccatgactgcagcgaccgctgaagaactgggactgcgcgttgatgtcatgcca
gagatcgccgaagtaccagaactgatcgacgctcttgcggaacacgtggcggatctgcgc
gctaagggcgagctgccgccgccgaggaagaaacgcaggcgtcgaaaagcgtcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system