KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0421Help
Entry
NCgl0421          CDS       T00102                                 

Gene name
Cgl0436
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461112..462458
Genome map
AA seq 448 aa AA seqDB search
MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTVPFASGPTDIGAEAFLA
ARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGVMGIPSNPPAGAQDTAFDW
TPGQDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDLGVRASVPALAAALDQLAEAG
EPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAELYEALAEQCGADIHLDSFVSAI
TKDGEGFAIKGGGEGTYDKVILAVPAPTAAVLLRDLAPAAAPHLRAIKLASSAVVGMRFD
SSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPHLEARGGALVRASFGRLGDEASARMDE
DLLVDAALDDLLTITGFDGRAAGLGEIFVQRWFGGLPAYGVDHIATVSAARAEIAAVPGV
EAIGAWAGGVGVPAVIADAQAAVHRLLG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgccatcatcggtgcaggccttgcgggtctgactgctgcatatgagatccat
aaagctgatcccactgcccaaatcgatgtgttggaagcaggcgaacgcattggcggcaag
ctttttacggtgccgtttgcttccggacctaccgatattggagcggaggcgtttttagct
gcgcgttccgatgcggtggagttttttactgagcttgggttggctgattctttggtcagc
ccgtctgctgcgaagtctcagtatttcgcgggcggtgcgctgcatgcgttccccgcaggt
ggagtgatgggtattccaagcaatccaccagcaggcgcgcaagacaccgcttttgattgg
actcctggccaagacatttctgttggcgccttagtgcgccgtcagtatggcgatgagatc
gtcgatactgtggtgtcttcgctgcttggtggcgtttattcctccaccgctgatgatctg
ggtgtgcgcgcttccgtgccggcacttgctgcagcccttgatcagctggctgaggccggc
gagccggtgactctgtcagctgcggtcaaggccgtggaagctcagcgggaagccgcaaaa
acaacttcagaaacccgccccgttttccagaccttcaagggcggatacgcggagctgtac
gaagcgttggcagagcaatgcggtgcagatattcacttggatagtttcgtttccgccatc
accaaagatggtgaaggttttgccatcaagggcggtggcgaaggcacctacgacaaggtg
attttggcggttcccgctccaaccgccgctgtgctgctccgcgacttggcaccggccgca
gcgccacatttgcgcgcaattaagttggcttcttcagcagtcgtcggcatgcgtttcgat
tccagcgagggcctgcccgacaactccggcgtcctggtcgctgttaatgagccgggcatc
acggcgaaggccttcacgttctcctcaaagaagtggcctcacctggaggctcgcgggggc
gcgctcgtgcgcgcgtcgttcggcaggctaggcgatgaggcgtcggcacgcatggacgag
gatttgcttgtcgacgccgccctcgacgatctcctcaccataaccgggttcgacggccgg
gctgccggactgggtgaaattttcgtgcagcgctggttcggtgggctcccagcctatgga
gttgatcacattgctaccgtttcggctgcgcgtgcagagatcgcagccgtgcctggcgtg
gaagcaattggcgcgtgggctgggggagtgggagttcccgcagttatcgcagatgcccag
gcagcagtacacaggttgctgggataa

DBGET integrated database retrieval system