KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0811Help
Entry
NCgl0811          CDS       T00102                                 

Gene name
Cgl0845
Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCgl0811 (Cgl0845)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NCgl0811 (Cgl0845)
Transfer RNA biogenesis [BR:cgl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NCgl0811 (Cgl0845)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(899250..900008)
Genome map
AA seq 252 aa AA seqDB search
MTAQIDDSILTHRLAQGTGEILKGVRNVGVLRGRNLGDAGDELAQSWIARVLEQHRPNDG
FLSEEAADNPDRLSKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGVPTHAAVGLPDLG
VVFHSADARAVTGPYSKVIAISHNRPPKVALSCAEQLGFETKALGSAGAKAMHVLLGDYD
AYIHAGGQYEWDSAAPVGVCKAAGLHCSRLDGSELTYNNKDTYMPDILICRPELADELLE
MCAKFYEENGTY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagattgatgattcgatcctcacccatcgtctcgcccaaggcaccggagaa
atcctcaaaggtgtccgcaatgttggggtgttaagaggtcggaatctcggtgatgccggc
gacgaactcgcacaaagttggattgctcgagtgttggagcagcaccgccccaacgatgga
ttcctgtctgaagaagccgccgacaacccagaccgcctatccaaggaccgcgtgtggatc
atcgatcccctcgacggcaccaaagaattcgccaccggccgccaggactgggcagtacac
atcgcactggtagaaaacggtgttcccacccacgccgctgttggcctccccgaccttggc
gtggtgttccactccgctgatgcccgcgccgtgactggcccttactccaaggtcatcgcc
atctcccacaaccgcccaccaaaggttgctctatcttgcgcagagcagctcggctttgaa
accaaggcccttggatccgcaggcgctaaagcaatgcacgttctcctcggtgactacgac
gcctacatccacgccggcggccaatacgagtgggattccgcagcaccagtcggcgtctgc
aaggcagcaggcttgcactgctccaggctcgacggttccgagctgacctacaacaacaaa
gacacctacatgccagacatcttgatctgtcgccctgaacttgcagatgaacttctcgag
atgtgcgcgaagttctacgaggagaatggaacttactaa

DBGET integrated database retrieval system