KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0874Help
Entry
NCgl0874          CDS       T00102                                 

Gene name
Cgl0911
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00900  Terpenoid backbone biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
Module
cgl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCgl0874 (Cgl0911)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NCgl0874 (Cgl0911)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 1018903
NCBI-ProteinID: NP_600139
UniProt: Q8NRY0
Position
965852..966787
Genome map
AA seq 311 aa AA seqDB search
MKITAKAWAKTNLHLGVGPAHDDGFHELMTVFQTIDLFDTVTLTTLDEELVEEGSVVKQL
SVTGARGVPEDASNLAWRAVDALVKRRAEKTPLSAVSLHISKGIPVAGGMAGGSADAAAT
LRAVDAWIGPFGEDTLLEVAAELGSDVPFCLLGGTMRGTGRGEQLVDMLTRGKLHWVVAA
MAHGLSTPEVFKKHDELNPESHMDISDLSAALLTGNTAEVGQWLHNDLTSAALSLRPELR
SVLQEGIRSGAHAGIVSGSGPTTVFLCESEHKAQDVKEALIDAGQVYAAYTATGPAASTA
DQRGAHILTVS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaccgctaaggcgtgggcgaaaaccaacctgcatttaggtgtgggaccggct
cacgacgatggatttcacgagctcatgacggtgtttcaaaccattgatctgtttgacacc
gtcaccttaaccaccctcgatgaggagttggtggaggaggggagcgtcgtcaagcaatta
tctgtgaccggtgcccgtggcgtgcctgaggacgccagcaatcttgcgtggcgcgctgtg
gatgcgttggttaagcggcgcgcggaaaagacgccgctgtctgcagtttcgctgcatatt
tccaaggggattccggtggctggcggcatggctggcggctctgcggatgcggctgcgaca
ctgcgcgcagtggatgcctggattgggcctttcggcgaggacacattgctggaggttgcc
gcggagctcggctcagatgtgccgttttgcctgcttggtggcaccatgcgcggtaccggt
cgcggcgagcagctggtagatatgttgacgcgcggcaagctacattgggtggtggccgcg
atggcgcatggcctgtccacgcctgaggtattcaaaaagcatgatgagctgaatccggaa
tcgcatatggatatcagcgacctcagcgccgcacttctcaccggcaacaccgccgaggtg
gggcagtggctgcacaatgatctgaccagcgccgcactcagtttgcgccctgaactgcgc
agcgtcctccaagaaggcatccgctccggcgcgcatgcaggaattgtctccggctccggc
ccgaccacggtattcttgtgcgaatcggagcacaaagcgcaagacgttaaagaggcgcta
atcgacgccggccaggtgtacgctgcttacaccgccaccggccctgcggcctcaaccgcc
gaccagcgcggcgcacacattttgactgtttcataa

DBGET integrated database retrieval system