KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0874Help
Entry
NCgl0874          CDS       T00102                                 

Gene name
Cgl0911
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCgl0874 (Cgl0911)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NCgl0874 (Cgl0911)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965852..966787
Genome map
AA seq 311 aa AA seqDB search
MKITAKAWAKTNLHLGVGPAHDDGFHELMTVFQTIDLFDTVTLTTLDEELVEEGSVVKQL
SVTGARGVPEDASNLAWRAVDALVKRRAEKTPLSAVSLHISKGIPVAGGMAGGSADAAAT
LRAVDAWIGPFGEDTLLEVAAELGSDVPFCLLGGTMRGTGRGEQLVDMLTRGKLHWVVAA
MAHGLSTPEVFKKHDELNPESHMDISDLSAALLTGNTAEVGQWLHNDLTSAALSLRPELR
SVLQEGIRSGAHAGIVSGSGPTTVFLCESEHKAQDVKEALIDAGQVYAAYTATGPAASTA
DQRGAHILTVS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaccgctaaggcgtgggcgaaaaccaacctgcatttaggtgtgggaccggct
cacgacgatggatttcacgagctcatgacggtgtttcaaaccattgatctgtttgacacc
gtcaccttaaccaccctcgatgaggagttggtggaggaggggagcgtcgtcaagcaatta
tctgtgaccggtgcccgtggcgtgcctgaggacgccagcaatcttgcgtggcgcgctgtg
gatgcgttggttaagcggcgcgcggaaaagacgccgctgtctgcagtttcgctgcatatt
tccaaggggattccggtggctggcggcatggctggcggctctgcggatgcggctgcgaca
ctgcgcgcagtggatgcctggattgggcctttcggcgaggacacattgctggaggttgcc
gcggagctcggctcagatgtgccgttttgcctgcttggtggcaccatgcgcggtaccggt
cgcggcgagcagctggtagatatgttgacgcgcggcaagctacattgggtggtggccgcg
atggcgcatggcctgtccacgcctgaggtattcaaaaagcatgatgagctgaatccggaa
tcgcatatggatatcagcgacctcagcgccgcacttctcaccggcaacaccgccgaggtg
gggcagtggctgcacaatgatctgaccagcgccgcactcagtttgcgccctgaactgcgc
agcgtcctccaagaaggcatccgctccggcgcgcatgcaggaattgtctccggctccggc
ccgaccacggtattcttgtgcgaatcggagcacaaagcgcaagacgttaaagaggcgcta
atcgacgccggccaggtgtacgctgcttacaccgccaccggccctgcggcctcaaccgcc
gaccagcgcggcgcacacattttgactgtttcataa

DBGET integrated database retrieval system