KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1064Help
Entry
NCgl1064          CDS       T00102                                 

Gene name
Cgl1109
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCgl1064 (Cgl1109)
  Amino acid metabolism
   00300 Lysine biosynthesis
    NCgl1064 (Cgl1109)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NCgl1064 (Cgl1109)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1155731..1156840
Genome map
AA seq 369 aa AA seqDB search
MNSELKPGLDLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNV
LARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLAT
STELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLR
IKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGV
ANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQ
VTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVA
AILKQYLSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctgaactcaaaccaggattagatctcctcggcgacccaattgtccttactcaa
cgtttggtagatataccgagtccgtcgggtcaggaaaagcagattgctgatgaaattgaa
gatgcccttcggaaccttaatctacctggtgtagaggtcttccgcttcaacaacaacgtt
cttgctcgcacgaacaggggattggcctcgagggtcatgcttgctggtcatatcgataca
gtgccgatcgcggacaatctgccaagccgtgtggaagacggcatcatgtatggctgtggc
accgtcgatatgaaatctgggttggcggtgtatttgcatacttttgccaccttggccacg
tcgactgagcttaaacatgatctgacgctgattgcgtatgagtgcgaggaagttgctgat
cacctcaatggtttgggccacattcgcgatgagcatccggagtggttggcggctgatttg
gcgttgttgggtgagcctactggcggctggattgaggcgggctgccagggcaatctgcgc
atcaaggtgacggcgcatggtgtgcgtgcccattcggcgagaagctggttgggtgataat
gcgatgcataagttgtcgccgatcatttcgaaggttgctgcgtataaggccgcagaagtc
aacattgatggcttgacctaccgtgaaggcctcaacatcgttttctgcgaatcgggcgtg
gcaaacaacgtcattccagacctcgcgtggatgaacctcaacttccgtttcgcgccgaat
cgcgatctcaacgaggcgatcgagcatgtcgtcgaaacgcttgagcttgacggtcaagac
ggcatcgaatgggccgtagaagacggggcaggcggtgcccttccaggcttggggcagcag
gtgacaagcgggcttatcgacgccgtcggccgcgaaaaaatccgcgcaaaattcggctgg
accgatgtctcacgtttttcagccatgggaattccagccctaaactttggcgctggtgat
ccaagtttcgcgcataaacgcgacgagcagtgcccagtggagcaaatcacggatgtggca
gcaattttgaagcagtacctgagcgagtaa

DBGET integrated database retrieval system