KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1066Help
Entry
NCgl1066          CDS       T00102                                 

Gene name
Cgl1111
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cgl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157694..1158527
Genome map
AA seq 277 aa AA seqDB search
MSSLPVIMAIVNRTPDSFYDKGATFEDTAALNRAAEVIEQGAGIVDIGGVKAGPGDFVSA
EEEIDRVVPIIAAVRERFPDIDISVDTWRASVADVAVAHGATLINDTWAGHDHELVQVAG
QHKVGYVCSHTGGVIPRTRPYRVHFDDIVADVITETTKLAEQAVRAGVPEERVFIDPTHD
FGKNTFHGLELLRRIDEVVATGWPVLMALSNKDFIGETLERGVDKRVAGTLAATAWAAAR
GVAAFRVHEVAETFDVLQMTAAIMGDVAPLNTIRGLA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttgccggtcatcatggccatcgtcaatcgcaccccggattctttctatgac
aagggtgcgacatttgaggacaccgctgcgctaaacagggcagcggaggtcattgaacaa
ggcgccggcattgtcgatatcggtggggtgaaagccggcccgggggatttcgtgtcggcg
gaggaagagatcgaccgcgtggtgccaatcatcgctgcggtgcgagaacgttttcctgac
attgatatttctgttgatacctggcgggcgtcggtggctgatgtcgcagtggcgcatgga
gcaacgctgatcaatgacacttgggccggccatgatcatgagttggtgcaggtagcaggg
cagcacaaggtgggttatgtctgctcgcacaccggcggggtgattccaagaacgcgacca
tatcgggtgcatttcgatgacatcgtggccgatgtaattacggagaccaccaaattggca
gagcaagctgttcgtgccggggtgccagaggaacgggtgtttattgatcccacccatgat
ttcgggaaaaacaccttccacggactggagcttttacgacggatcgatgaggtggttgcc
acgggctggccggtgctgatggccttgagtaataaggatttcattggggaaactttggaa
aggggcgtcgataagcgtgttgctggcacgcttgctgccactgcctgggcggcggcgcgc
ggcgttgcggcttttcgcgtgcatgaagttgcggaaacctttgacgttttgcagatgacg
gcggcgattatgggcgatgtggcgccacttaacaccattcgggggcttgcgtga

DBGET integrated database retrieval system