KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1177Help
Entry
NCgl1177          CDS       T00102                                 

Gene name
Cgl1224
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCgl1177 (Cgl1224)
Enzymes [BR:cgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NCgl1177 (Cgl1224)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCgl1177 (Cgl1224)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1287278..1289473)
Genome map
AA seq 731 aa AA seqDB search
MTVDPASHITIPEADLARLRHCNHHDPHGFYGWHETEAGSVIRTRQVGATQVNLLIDDTS
HVMTPIGDDIFAIDLGHRERADYRLEVTWPDQEPQVKADPYYFLPTVGEMDIYLFSEGRH
ERLWEILGANIKTYQTALGTVRGTAFTVWAPNAIGCAVVGGFNGWNASQHPMRSMGGSGL
WELFIPGIEEGEVYKFAVQTREGQRRDKADPMARRAELAPATGSIVASSEYQWQDSEWLR
ERSQTDLASKPMSVYEVHLGSWRWGKNYEDLATELVDYVADLGYTHVEFLPVAEHPFGGS
WGYQVTGYYAPTSRWGTPDQFRALVDAFHARGIGVIMDWVPAHFPKDDWALARFDGEALY
EHPDWRRGEQKDWGTLVFDFGRNEVRNFLVANALYWIEEFHIDGLRVDAVASMLYLDYSR
EHGEWEPNIYGGRENLEAVQFLQEMNATVLRLHPGALTIAEESTSWPGVTAPTWDGGLGF
SLKWNMGWMHDTLEYFSKNPVHRAFHHSELTFSLVYAFSERFVLPISHDEVVHGKGSLWD
RMPGDTWNKAAGLRTFLAYMWSHPGKKLLFMGQEFGQREEWAEGQGLPWDIVDGWQGEYH
EAIRTLTRSLNGVYSDSPALHTQDFTGEGFTWNKGDDATNNILAFTRFGSDGSQMLCVFN
LSGTSQPEYQLGVAAGGEWKLVLNTDDAEFLGAENDIATSVQAAATPRDNFAYSLSLHVP
AMSAQFYSLQK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaccccgcgagccacatcaccatccctgaagcagatctggcccgcctgcgc
cactgcaaccatcacgatcctcatggattttatggttggcatgagaccgaagctggttcg
gttatccgcacgcgccaggtcggcgcgacgcaggttaatttgcttatcgacgacacctcc
cacgtcatgacccctatcggcgacgacattttcgcaattgacttaggtcaccgcgagcgc
gctgactatcgcttggaagtcacctggcctgatcaagaaccgcaggtcaaggctgatcca
tactacttcctccccaccgtaggcgagatggatatttacctcttctctgagggacgccat
gagcgtttgtgggagattctcggtgccaacatcaagacctaccaaactgcgctcggaaca
gttcgtggcaccgcatttactgtgtgggctccaaacgcaattggctgcgcagtggtcggt
ggcttcaacggttggaatgcatcccagcatccgatgcgttctatgggtggttcgggtctg
tgggagctgttcatcccaggcatagaggaaggcgaagtgtacaaattcgccgtccaaacc
agggaaggccaacgtcgtgataaggccgatccgatggctcgtcgcgcagaactggcgccg
gcaaccggatctattgtcgcttcctctgagtaccagtggcaggattccgagtggctgcgc
gagcgttcccaaactgatctcgcatccaagccaatgagtgtctacgaggtccacctcggt
tcttggcgctggggtaagaactatgaggatttggctactgagctggttgattacgtcgca
gatcttggctacacccacgtggaattcctccctgtcgcagagcaccccttcggtggttcc
tggggttaccaggtcaccggctactacgcaccgacctctcgttggggtactccagatcag
ttccgtgcgctagtcgacgctttccacgcccgcggtattggcgtgatcatggactgggtt
cctgcccacttccctaaggatgattgggctcttgcccgctttgatggcgaagccctctat
gaacaccctgactggaggcgcggcgaacaaaaggattggggcaccctggtctttgacttc
ggtcgcaacgaagtccgcaacttcctcgtcgctaatgcgttgtactggattgaagaattc
cacatcgatggtctgcgcgtcgacgccgtggcctccatgctgtacctcgattactcccgt
gagcacggcgaatgggaaccaaacatctacggtggtcgcgagaacctcgaggcagtgcag
ttcctgcaggaaatgaacgccacggtgctgcgactgcaccctggtgcgctcaccatcgct
gaggaatcaacttcatggcctggcgtgaccgcaccaacgtgggacggcggcttgggattc
tccctcaagtggaacatgggctggatgcacgacaccttagagtacttctccaaaaaccct
gtgcaccgcgcattccaccacagtgagctcactttctccttggtgtacgcattctctgag
cgttttgtacttccgatctctcacgatgaagtcgtccacggcaagggttccctgtgggac
cgtatgcctggcgatacgtggaacaaggccgctggtcttcgcaccttccttgcgtacatg
tggtcacacccaggcaagaagctgcttttcatgggtcaggagtttggtcagcgtgaagag
tgggctgaaggccagggactgccatgggatattgtcgacggctggcaaggcgagtaccac
gaagccatccgcactctgacccgctccctcaacggtgtctactcagactcccctgcgctg
cacactcaggatttcaccggagaaggcttcacatggaataagggcgacgacgccaccaac
aacattttggcgttcactcgtttcggcagcgacggctcccagatgctgtgtgtattcaac
ctgtctggaacctcccagcctgagtaccagctcggtgttgcagcgggtggcgaatggaag
ctcgttctcaacactgatgatgctgaattcctcggtgcagaaaacgatatcgctacttcc
gttcaagcagcagcgacaccacgcgataatttcgcctactcactctcactgcatgtccca
gcgatgagtgctcagttctactcactgcagaagtag

DBGET integrated database retrieval system