KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1202Help
Entry
NCgl1202          CDS       T00102                                 

Gene name
Cgl1250
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00010  Glycolysis / Gluconeogenesis
cgl00030  Pentose phosphate pathway
cgl00051  Fructose and mannose metabolism
cgl00052  Galactose metabolism
cgl00680  Methane metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl1202 (Cgl1250)
   00030 Pentose phosphate pathway
    NCgl1202 (Cgl1250)
   00051 Fructose and mannose metabolism
    NCgl1202 (Cgl1250)
   00052 Galactose metabolism
    NCgl1202 (Cgl1250)
  Energy metabolism
   00680 Methane metabolism
    NCgl1202 (Cgl1250)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCgl1202 (Cgl1250)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NCgl1202 (Cgl1250)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 1019232
NCBI-ProteinID: NP_600473
UniProt: Q8NR14
Position
1315046..1316086
Genome map
AA seq 346 aa AA seqDB search
MEDMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLGDRRVQLYDDED
IDRILLRGGTILGTGRLHPDKFKAGIDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNG
IPVVGVPKTIDNDVNGTDFTFGFDTAVAVATDAVDRLHTTAESHNRVMIVEVMGRHVGWI
ALHAGMAGGAHYTVIPEVPFDIAEICKAMERRFQMGEKYGIIVVAEGALPREGTMELREG
HIDQFGHKTFTGIGQQIADEIHVRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAAR
ACHEGSFDKVVALKGESIEMITFEEAVGTLKEVPFERWVTAQAMFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatgcgaattgctactctcacgtcaggcggcgactgccccggactaaacgcc
gtcatccgaggaatcgtccgcacagccagcaatgaatttggctccaccgtcgttggttat
caagacggttgggaaggactgttaggcgatcgtcgcgtacagctgtatgacgatgaagat
attgaccgaatcctccttcgaggcggcaccattttgggcactggtcgcctccatccggac
aagtttaaggccggaattgatcagattaaggccaacttagaagacgccggcatcgatgcc
cttatcccaatcggtggcgaaggaaccctgaagggtgccaagtggctgtctgataacggt
atccctgttgtcggtgtcccaaagaccattgacaatgacgtgaatggcactgacttcacc
ttcggtttcgatactgctgtggcagtggctaccgacgctgttgaccgcctgcacaccacc
gctgaatctcacaaccgtgtgatgatcgtggaggtcatgggccgccacgtgggttggatt
gctctgcacgcaggtatggccggcggtgctcactacaccgttattccagaagtacctttc
gatattgcagagatctgcaaggcgatggaacgtcgcttccagatgggcgagaagtacggc
attatcgtcgttgcggaaggtgcgttgccacgcgaaggcaccatggagcttcgtgaaggc
cacattgaccagttcggtcacaagaccttcacgggaattggacagcagatcgctgatgag
atccacgtgcgcctcggccacgatgttcgtacgaccgttcttggccacattcaacgtggt
ggaaccccaactgctttcgaccgtgttctggccactcgttatggtgttcgtgcagctcgt
gcgtgccatgagggaagctttgacaaggttgttgctttgaagggtgagagcattgagatg
atcacctttgaagaagcagtcggaaccttgaaggaagttccattcgaacgctgggttact
gcccaggcaatgtttggatag

DBGET integrated database retrieval system