KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1202Help
Entry
NCgl1202          CDS       T00102                                 

Gene name
Cgl1250
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl1202 (Cgl1250)
   01230 Biosynthesis of amino acids
    NCgl1202 (Cgl1250)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl1202 (Cgl1250)
   00030 Pentose phosphate pathway
    NCgl1202 (Cgl1250)
   00051 Fructose and mannose metabolism
    NCgl1202 (Cgl1250)
   00052 Galactose metabolism
    NCgl1202 (Cgl1250)
  Energy metabolism
   00680 Methane metabolism
    NCgl1202 (Cgl1250)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCgl1202 (Cgl1250)
Protein phosphatases and associated proteins [BR:cgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCgl1202 (Cgl1250)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315046..1316086
Genome map
AA seq 346 aa AA seqDB search
MEDMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLGDRRVQLYDDED
IDRILLRGGTILGTGRLHPDKFKAGIDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNG
IPVVGVPKTIDNDVNGTDFTFGFDTAVAVATDAVDRLHTTAESHNRVMIVEVMGRHVGWI
ALHAGMAGGAHYTVIPEVPFDIAEICKAMERRFQMGEKYGIIVVAEGALPREGTMELREG
HIDQFGHKTFTGIGQQIADEIHVRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAAR
ACHEGSFDKVVALKGESIEMITFEEAVGTLKEVPFERWVTAQAMFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatgcgaattgctactctcacgtcaggcggcgactgccccggactaaacgcc
gtcatccgaggaatcgtccgcacagccagcaatgaatttggctccaccgtcgttggttat
caagacggttgggaaggactgttaggcgatcgtcgcgtacagctgtatgacgatgaagat
attgaccgaatcctccttcgaggcggcaccattttgggcactggtcgcctccatccggac
aagtttaaggccggaattgatcagattaaggccaacttagaagacgccggcatcgatgcc
cttatcccaatcggtggcgaaggaaccctgaagggtgccaagtggctgtctgataacggt
atccctgttgtcggtgtcccaaagaccattgacaatgacgtgaatggcactgacttcacc
ttcggtttcgatactgctgtggcagtggctaccgacgctgttgaccgcctgcacaccacc
gctgaatctcacaaccgtgtgatgatcgtggaggtcatgggccgccacgtgggttggatt
gctctgcacgcaggtatggccggcggtgctcactacaccgttattccagaagtacctttc
gatattgcagagatctgcaaggcgatggaacgtcgcttccagatgggcgagaagtacggc
attatcgtcgttgcggaaggtgcgttgccacgcgaaggcaccatggagcttcgtgaaggc
cacattgaccagttcggtcacaagaccttcacgggaattggacagcagatcgctgatgag
atccacgtgcgcctcggccacgatgttcgtacgaccgttcttggccacattcaacgtggt
ggaaccccaactgctttcgaccgtgttctggccactcgttatggtgttcgtgcagctcgt
gcgtgccatgagggaagctttgacaaggttgttgctttgaagggtgagagcattgagatg
atcacctttgaagaagcagtcggaaccttgaaggaagttccattcgaacgctgggttact
gcccaggcaatgtttggatag

DBGET integrated database retrieval system