KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1311Help
Entry
NCgl1311          CDS       T00102                                 

Gene name
Cgl1366
Definition
(RefSeq) sugar kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCgl1311 (Cgl1366)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NCgl1311 (Cgl1366)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase XdhC_C
Motif
Other DBs
NCBI-GeneID: 1019341
NCBI-ProteinID: NP_600583
UniProt: Q8NQR0
Position
complement(1430656..1431579)
Genome map
AA seq 307 aa AA seqDB search
MSNSTGTDIVVVGSINADLTAKVQRHPEPGETLLGSGGTVSAGGKGANQAVAAAQLGAKV
TMIGAVGTDQMAGEALTHLRQSGADMSAIATVDGPTGLAIITVSDDGENTIIVIPGANAS
VTAEFVDKHSQLIENAGIVLLQGEIPADGFERAVDLSQGRVVINLAPVVPVGHDQLRRAD
PLLVNEHEGALVLDMLGTPATTSDPQSLVTELLEQGFTSVVMTLGAEGALVGTPGQLTAI
PTPKIQAVDTTGSGDAFAGALVAKLSEGAGLIEAATFAARVGAYAATRPGAQASYPTLTT
DLPSTTH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcaaccggtaccgacattgtcgttgtcggatccatcaatgccgatctcacc
gcaaaagttcaacgccaccctgaacctggagaaaccctcctgggtagcggcggcacagtg
agtgctggtggcaaaggcgccaaccaagctgtggcggcagcgcaattaggtgccaaagtc
accatgatcggtgcggtcggaaccgatcaaatggctggcgaggcgctgacacatttgcgt
caatcaggagcagatatgtccgcgattgccactgtggacggtcccactggtcttgccatc
atcactgtgtctgacgatggggaaaacaccatcatcgttatccctggcgctaacgcttct
gtcaccgcggaatttgttgataaacactcccaactcattgagaacgccggcattgtgttg
cttcagggtgagatccctgccgatggtttcgagcgtgccgttgatctttcacaaggacgt
gtggtgatcaatctggctccagttgtgcccgtgggacatgatcagctgcgtcgtgccgat
ccattgctggtcaacgaacacgaaggcgctctggtgctggacatgcttggaactccagcg
accacgtctgatccccaaagtttggtcactgaattgctggagcagggttttacttccgtg
gtgatgacacttggtgccgaaggtgctctggttggcacgccgggccaactcacggcaatt
cctaccccaaagatccaggcagtcgacacaaccggaagtggagacgcgtttgcgggggca
ctcgtcgcaaagctctctgaaggcgctggccttattgaggcggcaacttttgctgcgcgc
gttggcgcttatgccgccacgaggccgggcgctcaagcctcctaccccaccctgaccact
gacctcccctcaaccactcactga

DBGET integrated database retrieval system