KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1524Help
Entry
NCgl1524          CDS       T00102                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl1524 (tpiA)
   01230 Biosynthesis of amino acids
    NCgl1524 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl1524 (tpiA)
   00051 Fructose and mannose metabolism
    NCgl1524 (tpiA)
   00562 Inositol phosphate metabolism
    NCgl1524 (tpiA)
Enzymes [BR:cgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCgl1524 (tpiA)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCgl1524 (tpiA)
  Exosomal proteins of bladder cancer cells
   NCgl1524 (tpiA)
  Exosomal proteins of melanoma cells
   NCgl1524 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1680329..1681108)
Genome map
AA seq 259 aa AA seqDB search
MARKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGD
KLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKA
ALSNGISPIVCVGEPLEIREAGTHVEYVVEQTRKSLAGLDAAELANTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAASVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagccacttatcgctggtaactggaagatgaacctggatcaccagcaggca
atcggcactgttcagaagcttgcattcgcccttccaaaggaatacttcgagaaggttgac
gttgcagtcaccgttcctttcactgacatccgctccgtccagactctcgttgagggcgac
aagcttgaggtcactttcggtgctcaggacgtctcccagcacgagtccggtgcgtacacc
ggtgaagtttctgcaagcatgctggcaaagttgaactgctcttgggttgtcgttggacac
tccgagcgccgcgagtaccacaacgagtctgatgagttggttgctgcgaaggcaaaggca
gctctgtccaacggcatcagcccgatcgtctgcgttggtgagccactggaaatccgtgaa
gctggcacccacgttgagtacgtcgtcgagcagacccgtaagtcccttgctggcctggat
gctgctgagctggccaacaccgttatcgcgtatgagccagtgtgggctatcggcaccggt
aaggttgcttccgcagctgacgctcaggaagtgtgcaaggctatccgcggtctgatcgtg
gagcttgcaggcgacgaggtcgctgagggcctgcgtattctttacggtggttctgttaag
gcagaaaccgtcgctgagatcgtcggtcagcctgacgtcgacggcggacttgtcggtggc
gcttccctcgacggtgaagcattcgccaagctggctgccaacgctgcgagcgttgcttaa

DBGET integrated database retrieval system