KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1597Help
Entry
NCgl1597          CDS       T00102                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NCgl1597 (ruvA)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NCgl1597 (ruvA)
DNA repair and recombination proteins [BR:cgl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NCgl1597 (ruvA)
    RecFOR pathway proteins
     NCgl1597 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762514..1763134)
Genome map
AA seq 206 aa AA seqDB search
MIASLRGTVINIGLSSAVIECNGVGYEVVTTPNTLSQLVRGEEALVLTTMVVREDAMKLY
GFIDNESREMFSVLQTVSGLGPRLALACESVLSPLEISQAITNADAKTLQRVPGVGKRMA
DRLIVELKGKVAAFAAGVVDEGGEQISLPNANIASEVVVEQVSQALVGLGFSEKQSDDAV
SFVLAADPSLDTSGALRAALAKLSGK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcacttcgtggcactgttatcaacattggtctgagctctgctgtcattgaa
tgcaatggcgtgggctatgaggttgtcaccacaccgaacaccttgtcacagttggtccgc
ggtgaggaagcactggtgttgaccaccatggtggtccgcgaagacgcgatgaaactctat
gggtttattgacaatgaatcacgtgagatgttttccgtgttgcaaacagtatctggattg
ggtccacgcctggccttggcatgtgaatcggtgttgagcccactggagatttctcaggcg
atcaccaatgccgatgccaaaactttgcagcgggttccgggtgtgggaaagcgcatggca
gatcgtctcatcgtggagcttaaaggcaaggtcgcagcttttgctgccggtgtcgtggat
gagggaggggagcaaatttccttgcctaacgcgaacattgcttctgaggtggttgtggag
caggtttctcaagcgctggtggggttgggctttagcgagaagcaatcagatgatgcagtg
agctttgtgctggcggcggatccatccttggacaccagtggcgcgcttcgtgccgcattg
gcaaaactcagcggaaagtag

DBGET integrated database retrieval system