KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1597Help
Entry
NCgl1597          CDS       T00102                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NCgl1597 (ruvA)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NCgl1597 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762514..1763134)
Genome map
AA seq 206 aa AA seqDB search
MIASLRGTVINIGLSSAVIECNGVGYEVVTTPNTLSQLVRGEEALVLTTMVVREDAMKLY
GFIDNESREMFSVLQTVSGLGPRLALACESVLSPLEISQAITNADAKTLQRVPGVGKRMA
DRLIVELKGKVAAFAAGVVDEGGEQISLPNANIASEVVVEQVSQALVGLGFSEKQSDDAV
SFVLAADPSLDTSGALRAALAKLSGK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcacttcgtggcactgttatcaacattggtctgagctctgctgtcattgaa
tgcaatggcgtgggctatgaggttgtcaccacaccgaacaccttgtcacagttggtccgc
ggtgaggaagcactggtgttgaccaccatggtggtccgcgaagacgcgatgaaactctat
gggtttattgacaatgaatcacgtgagatgttttccgtgttgcaaacagtatctggattg
ggtccacgcctggccttggcatgtgaatcggtgttgagcccactggagatttctcaggcg
atcaccaatgccgatgccaaaactttgcagcgggttccgggtgtgggaaagcgcatggca
gatcgtctcatcgtggagcttaaaggcaaggtcgcagcttttgctgccggtgtcgtggat
gagggaggggagcaaatttccttgcctaacgcgaacattgcttctgaggtggttgtggag
caggtttctcaagcgctggtggggttgggctttagcgagaagcaatcagatgatgcagtg
agctttgtgctggcggcggatccatccttggacaccagtggcgcgcttcgtgccgcattg
gcaaaactcagcggaaagtag

DBGET integrated database retrieval system