KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1835Help
Entry
NCgl1835          CDS       T00102                                 

Gene name
Cgl1910
Definition
(RefSeq) transcriptional regulator
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00010  Glycolysis / Gluconeogenesis
cgl00520  Amino sugar and nucleotide sugar metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01200  Carbon metabolism
Module
cgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl1835 (Cgl1910)
   00520 Amino sugar and nucleotide sugar metabolism
    NCgl1835 (Cgl1910)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     NCgl1835 (Cgl1910)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 1019867
NCBI-ProteinID: NP_601116
UniProt: Q8NPA4
Position
2010633..2011385
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFG
NPAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAASVKENEDLSW
KKWAKHLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLMELDTDIVPAELRNRAGIVGA
AMAVNQHLTP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccacccctaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtcggtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aaccctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcatccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcacctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgatg
gagctagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system