KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1835Help
Entry
NCgl1835          CDS       T00102                                 

Gene name
Cgl1910
Definition
transcriptional regulator (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgl00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cgl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010633..2011385
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFG
NPAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAASVKENEDLSW
KKWAKHLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLMELDTDIVPAELRNRAGIVGA
AMAVNQHLTP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccacccctaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtcggtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aaccctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcatccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcacctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgatg
gagctagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system