KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1922Help
Entry
NCgl1922          CDS       T00102                                 

Gene name
Cgl1997
Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCgl1922 (Cgl1997)
Enzymes [BR:cgl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     NCgl1922 (Cgl1997)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2109152..2110255)
Genome map
AA seq 367 aa AA seqDB search
MASQQIRYPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLGDAP
LVNLPLGSTEDRVVGSLNMETVLTTGRAEYQPGLLAQADGGVLYVDEVNLLADHLVDALL
DAAASGRVSIERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVAASTNPEVRV
EIIRRRLDFENAPEQFMAKWAEQDADTSNRILAAKDLLPGVELPDLILSQIAWLCARIEV
DGMRADLVITRTALAHAAWAGRTVVTEEDVEIAARLALPHRRRRNPFDAPEMEERKLQET
LQEARDFFKDNEDKGPAAKITDEETGAEAFTDTDNPTEEDGLQGTAQAKAQTTGKVGTAG
SGDPFRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacaacagatccgctatccattctccgcggttgtgggacaagacgagcttcgg
cttgcgttgatcctcactgcgatttccccacgcattggtggcgtggtgattcgaggtgag
aagggtacagcgaaaactaccactgtgcgtgcttttgctggtcttttaggtgatgcccct
ttggtgaacttgcctctcggatccacggaggatcgtgtggtgggttccctcaacatggaa
actgtgttgaccaccggccgtgcggaatatcagccaggtttgctcgcgcaggctgatggc
ggtgtgctgtatgtcgatgaggtcaacctcttggcggatcacctggtggatgctctgctc
gatgcagctgcaagcggtcgcgtcagcattgagcgtgacggtatttcgcattcttcacca
gcaaactttgtgttggtgggcaccatgaatccggaggaaggcgagctgcgcccgcagctg
ctggaccgtttcggtttggctgtggacgttgctgcgtctacgaaccctgaggtgcgcgtg
gagatcattcgccgccggcttgattttgaaaacgctcctgagcagttcatggctaagtgg
gctgagcaagatgcggacacctccaaccgtattttggcggctaaggatttgctgcctggt
gtggagctgccggatctgatcttgtcgcagattgcgtggttgtgtgcacgtattgaagtc
gacggtatgcgcgctgacctggtgatcacgcgtaccgcacttgctcacgccgcgtgggct
ggacgcactgtggttacggaagaagacgtggagatcgcagctcgcctagcgttgccgcac
cgccgtcgccgtaatcctttcgatgctccagaaatggaggagcgcaagcttcaggaaacc
ctgcaggaagctcgggacttcttcaaagacaatgaagataaaggacctgccgccaagatc
accgatgaggaaaccggtgcagaggcctttaccgataccgacaatcccaccgaggaagac
ggtctgcaaggaactgcgcaggcgaaggcgcagactactggaaaggtaggtactgccgga
tccggcgacccctttcgctcctag

DBGET integrated database retrieval system