KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2010Help
Entry
NCgl2010          CDS       T00102                                 

Gene name
Cgl2091
Definition
(RefSeq) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCgl2010 (Cgl2091)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl2010 (Cgl2091)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCgl2010 (Cgl2091)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2208364..2209149)
Genome map
AA seq 261 aa AA seqDB search
MVATENRMLMEIAAEISAREATLGFQEVKTKSRSAGLTAAFDIASVFFSSGCNVVVAFDR
FASNWSDHSDHVDYAAQVAGFGASMLAYTVRRGQFDTAVRDIRDIKSEVDIPILLHDPII
DPYQIHEARVMGIDALQFPVWAMEQARLESLVDRTESLGMTAIVSVRNHEEAHRAVDAGA
TVVAIDITGYTGSLTLPEAFSGITQFMPKEVARIVLGGCSSPKELMRFARHSADAIFVPH
ADLATTKSLVTAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagagaaccgcatgttgatggaaatcgctgcggaaatatcggctcgggaa
gcaacgcttggttttcaagaagtcaaaactaaatctcgatcagcaggtctcacggcggct
ttcgatattgcttcagtctttttttcgtctggatgtaatgtcgtagtcgcctttgatcgt
tttgcatccaattggtctgatcattcggatcatgtggactacgctgcacaggttgcgggt
tttggcgcatcaatgcttgcatatacggtgcgcaggggacagtttgataccgcagtacgc
gatatcagggacatcaaatctgaagtagacattcccattctgcttcatgatcccatcatc
gatccgtatcaaatccacgaagcccgcgtcatgggcatcgacgctcttcaattccccgta
tgggcgatggaacaagctcgactggaatctttggtggaccgcaccgaatcattgggcatg
acagccatcgtgtctgtgcgaaaccacgaagaagcgcatcgtgcagtggacgcaggagcg
acagtggtagcaattgatattactggttataccggctcactcactttgcctgaagcgttt
tcgggtatcacccaattcatgcccaaagaggtagcccgcattgtgctcggaggttgcagc
agccctaaagaactcatgcggtttgcacgacattctgcagacgccatctttgttccacat
gcagacctcgccaccacaaaatctcttgtgacagcaggtatgcatccagcgtgcccatcg
cgttga

DBGET integrated database retrieval system