KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2010Help
Entry
NCgl2010          CDS       T00102                                 

Gene name
Cgl2091
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl2010 (Cgl2091)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCgl2010 (Cgl2091)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-GeneID: 1020042
NCBI-ProteinID: NP_601290
UniProt: Q8NNU1
Position
complement(2208364..2209149)
Genome map
AA seq 261 aa AA seqDB search
MVATENRMLMEIAAEISAREATLGFQEVKTKSRSAGLTAAFDIASVFFSSGCNVVVAFDR
FASNWSDHSDHVDYAAQVAGFGASMLAYTVRRGQFDTAVRDIRDIKSEVDIPILLHDPII
DPYQIHEARVMGIDALQFPVWAMEQARLESLVDRTESLGMTAIVSVRNHEEAHRAVDAGA
TVVAIDITGYTGSLTLPEAFSGITQFMPKEVARIVLGGCSSPKELMRFARHSADAIFVPH
ADLATTKSLVTAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagagaaccgcatgttgatggaaatcgctgcggaaatatcggctcgggaa
gcaacgcttggttttcaagaagtcaaaactaaatctcgatcagcaggtctcacggcggct
ttcgatattgcttcagtctttttttcgtctggatgtaatgtcgtagtcgcctttgatcgt
tttgcatccaattggtctgatcattcggatcatgtggactacgctgcacaggttgcgggt
tttggcgcatcaatgcttgcatatacggtgcgcaggggacagtttgataccgcagtacgc
gatatcagggacatcaaatctgaagtagacattcccattctgcttcatgatcccatcatc
gatccgtatcaaatccacgaagcccgcgtcatgggcatcgacgctcttcaattccccgta
tgggcgatggaacaagctcgactggaatctttggtggaccgcaccgaatcattgggcatg
acagccatcgtgtctgtgcgaaaccacgaagaagcgcatcgtgcagtggacgcaggagcg
acagtggtagcaattgatattactggttataccggctcactcactttgcctgaagcgttt
tcgggtatcacccaattcatgcccaaagaggtagcccgcattgtgctcggaggttgcagc
agccctaaagaactcatgcggtttgcacgacattctgcagacgccatctttgttccacat
gcagacctcgccaccacaaaatctcttgtgacagcaggtatgcatccagcgtgcccatcg
cgttga

DBGET integrated database retrieval system