KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2021Help
Entry
NCgl2021          CDS       T00102                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cgl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2217597..2218925)
Genome map
AA seq 442 aa AA seqDB search
MLNVTDLRGQTPSKSDIRRALPRGGTDVWSVLPIVQPVVEDVQNRGAEAALDYGEKFDHI
RPASVRVPAEVIAAAENTLDPLVRESIEESIRRVRKVHAEQKPSEHTTELSPGGTVTERF
MPIDRVGLYVPGGNAVYPSSVIMNTVPAQEAGVNSLVVASPPQAEHGGWPHPTILAACSI
LGVDEVWAVGGGQAVALLAYGDDAAGLEPVDMITGPGNIFVTAAKRLVRGVVGTDSEAGP
TEIAVLADASANAVNVAYDLISQAEHDVMAASVLITDSEQLAKDVNREIEARYSITRNAE
RVAEALRGAQSGIVLVDDISVGIQVADQYAAEHLEIHTENARAVAEQITNAGAIFVGDFS
PVPLGDYSAGSNHVLPTSGSARFSAGLSTHTFLRPVNLIEYDEAALKDVSQVVINFANAE
DLPAHGEAIRARFENLPTTDEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcactgacctgcgaggtcaaacaccatccaagagcgacatccgacgtgct
ttgccacgtggtggcactgacgtgtggtctgtgcttcccatagtgcagcctgttgtagaa
gatgtccaaaaccgcggcgctgaagctgctttggattacggcgagaagttcgaccatatt
cgccccgcctcggtgcgggtgccagctgaggttattgctgcagcagaaaacaccttagat
ccgttggtgcgtgaatcgattgaagagtcgattcgtcgcgtccgcaaggttcacgctgag
caaaagccatccgagcacaccactgaactttcaccaggtggcaccgtcactgagcgtttc
atgccgattgatcgcgtgggactgtacgttccaggcggcaatgcggtgtacccatcaagc
gtgattatgaatactgtcccagctcaagaggctggtgtgaactcccttgtggttgcgtcg
cctcctcaggctgagcacggtggctggcctcaccccaccattttggcggcgtgttccatc
ttgggtgttgatgaggtgtgggctgtcggcggcggtcaggccgtggcgttgctggcttat
ggtgatgacgctgcaggtctcgagcctgtggatatgatcactggacctggcaatatcttt
gtcaccgctgcgaagcgcctggtcaggggagtggtaggtactgattctgaggctggccct
acagaaatcgctgtgcttgctgatgcctctgccaacgccgtcaacgttgcctacgatctg
atcagccaagcagaacacgatgtcatggctgcgtccgtgctcatcactgactccgagcag
cttgccaaggacgtaaacagggaaatcgaggcgcgttactcaatcacgcgcaacgccgag
cgcgtcgcagaagctttgcgcggggcccagagtggcatcgtgcttgtcgacgacatttcc
gtgggtatccaagtagccgatcaatacgcagcggaacacctggaaatccacactgagaac
gcgcgcgccgtagcagagcagatcaccaacgcgggtgcgatcttcgtgggcgatttctca
ccagtaccactgggtgattactccgcaggatccaaccacgtgctgccaacctctggatcc
gctcgtttctccgcaggtctatccacgcacacgttccttcgcccagtcaacctcattgaa
tacgatgaggctgctctgaaggacgtctcgcaggttgtcatcaactttgccaacgccgaa
gatcttccagcgcacggcgaagcaatccgtgcacgctttgaaaacctccccaccaccgac
gaggcctaa

DBGET integrated database retrieval system