KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2116Help
Entry
NCgl2116          CDS       T00102                                 

Gene name
Cgl2196
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCgl2116 (Cgl2196)
Enzymes [BR:cgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NCgl2116 (Cgl2196)
Peptidases [BR:cgl01002]
 Cysteine Peptidases
  Family C44
   NCgl2116 (Cgl2196)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2328517..2330439
Genome map
AA seq 640 aa AA seqDB search
MCGLLGILTANGNAEAFVPALERALPCMRHRGPDDAGTWHDADAAFGFNRLSIIDIAHSH
QPLRWGPADEPDRYAMTFNGEIYNYVELRKELSDLGYAFNTSGDGEPIVVGFHHWGESVV
EHLRGMFGIAIWDTKEKSLFLARDQFGIKPLFYATTEHGTVFSSEKKTILEMAEEMNLDL
GLDKRTIEHYVDLQYVPEPDTLHAQISRLESGCTATVRPGGKLEQKRYFKPQFPVQKVVK
GKEQDLFDRIAQVLEDSVEKHMRADVTVGSFLSGGIDSTAIAALAKRHNPDLLTFTTGFE
REGYSEVDVAAESAAAIGAEHIVKIVSPEEYANAIPKIMWYLDDPVADPSLVPLYFVAAE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRKGLGKLSKVLPDGMKGKSL
LERGSMTMEERYYGNARSFNFEQMQRVIPWAKREWDHREVTAPIYAQSRNFDPVARMQHL
DLFTWMRGDILVKADKINMANSLELRVPFLDKEVFKVAETIPYDLKIANGTTKYALRRAL
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTIKESGTEDIFNKQAVLDMLNEHRD
GVSDHSRRLWTVLSFMVWHGIFVENRIDPQIEDRSYPVEL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggccttcttggcatattgactgcaaatgggaacgctgaagcattcgttcctgca
ctcgagcgggccttgccatgcatgcgccaccgtggtcctgacgatgccggcacttggcat
gacgccgatgcagcgtttggattcaaccgcctctccatcattgatattgcacactcccac
caaccactgcgttggggacctgcggatgaacccgaccgctacgcaatgactttcaacggt
gagatctacaactacgttgagctgcgtaaagagctctcggatttgggatatgcctttaat
acttctggcgatggcgagccaattgttgtcggtttccaccactggggcgagtccgtggtc
gagcatctccgcggaatgttcggcattgccatttgggatacaaaggaaaagtcgcttttc
cttgcgcgtgatcagttcggcattaagccactgttctacgcaaccaccgagcatggcacc
gtgttctcctcagagaagaagaccatcttggagatggccgaggagatgaatctagatctg
ggccttgataagcgcaccattgagcactacgtggacttgcagtacgtgcccgagccagat
acccttcacgcgcagatttcccgcttggagtcaggctgcaccgcaacagttcgtccgggc
ggcaagctggaacagaagcgttacttcaagcctcagttcccagtacagaaggtcgtaaag
ggtaaggagcaggacctcttcgatcgcattgcccaggtgttggaggatagcgtcgaaaag
catatgcgtgccgacgtgaccgtaggctcgttcctttccggcggcattgactcaaccgca
attgcggcgcttgcaaagcgccacaaccctgacctgctcaccttcaccaccggtttcgag
cgtgaaggctactcggaggtcgatgtggctgcggagtccgccgctgcgattggcgctgag
cacatcgtgaagattgtctcgcctgaggaatacgccaacgcgattcctaagatcatgtgg
tacttggatgatcctgtagctgacccatcattggtcccgctgtacttcgtggcagcggaa
gcacgtaagcacgtcaaggttgtgctgtctggcgagggcgcagatgagctgttcggtgga
tacaccatttacaaggagccgctatcgcttgctccatttgagaagatcccttccccacta
cgtaaaggcctgggaaagctcagcaaggttctgccagacggcatgaagggcaagtccctt
cttgagcgtggctccatgaccatggaagagcgctactacggcaacgctcgctccttcaat
ttcgagcagatgcaacgcgttattccatgggcaaagcgcgaatgggaccaccgcgaagtc
actgcgccgatctacgcacagtcccgcaactttgatccagtagcccgcatgcaacacctg
gatctgttcacctggatgcgcggcgacatcctggtcaaggctgacaagatcaacatggcg
aactcccttgagctgcgagttccattcttggataaggaagttttcaaggttgcagagacc
attccttacgacctgaagattgccaacggtaccaccaagtacgcgctgcgcagggcactc
gagcagattgttccgcctcacgttttgcaccgcaagaagctgggcttccctgttcccatg
cgccactggcttgccggcgatgagctgttcggttgggcgcaggacaccatcaaggaatcc
ggtactgaagatatcttcaacaagcaggctgtgctggatatgctgaacgagcaccgcgat
ggcgtgtcagatcattcccgtcgactgtggactgttctgtcatttatggtgtggcacggc
atttttgtggaaaaccgcattgatccacagattgaggaccgctcctacccagtcgagctt
taa

DBGET integrated database retrieval system