KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2139Help
Entry
NCgl2139          CDS       T00102                                 

Gene name
Cgl2220
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCgl2139 (Cgl2220)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCgl2139 (Cgl2220)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NCgl2139 (Cgl2220)
Enzymes [BR:cgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NCgl2139 (Cgl2220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2353598..2355043)
Genome map
AA seq 481 aa AA seqDB search
MDYISTRDASRTPARFSDILLGGLAPDGGLYLPATYPQLDDAQLSKWREVLANEGYAALA
AEVISLFVDDIPVEDIKAITARAYTYPKFNSEDIVPVTELEDNIYLGHLSEGPTAAFKDM
AMQLLGELFEYELRRRNETINILGATSGDTGSSAEYAMRGREGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADAEFKKDNRIGAVNSINWARLMAQVVYY
VSSWIRTTTSNDQKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTHETSSPSMDISRASNFERFIFDLLGRDATRVNDLFGTQVRQGGFSLADDA
NFEKAAAEYGFASGRSTHADRVATIADVHSRLDVLIDPHTADGVHVARQWRDEVNTPIIV
LETALPVKFADTIVEAIGEAPQTPERFAAIMDAPFKVSDLPNDTDAVKQYIVDAIANTSV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcgacgcgtgatgccagccgtacccctgcccgcttcagtgatattttg
ctgggcggtctagcaccagacggcggcctgtacctgcctgcaacctaccctcaactagat
gatgcccagctgagtaaatggcgtgaggtattagccaacgaaggatacgcagctttggct
gctgaagttatctccctgtttgttgatgacatcccagtagaagacatcaaggcgatcacc
gcacgcgcctacacctacccgaagttcaacagcgaagacatcgttcctgtcaccgaactc
gaggacaacatttacctgggccacctttccgaaggcccaaccgctgcattcaaagacatg
gccatgcagctgctcggcgaacttttcgaatacgagcttcgccgccgcaacgaaaccatc
aacatcctgggcgctacctctggcgataccggctcctctgcggaatacgccatgcgcggc
cgcgagggaatccgcgtattcatgctgaccccagctggccgcatgaccccattccagcaa
gcacagatgtttggccttgacgatccaaacatcttcaacatcgccctcgacggcgttttc
gacgattgccaagacgtagtcaaggctgtctccgccgacgcagaattcaaaaaagacaac
cgcatcggtgccgtgaactccatcaactgggcacgccttatggcacaggttgtgtactac
gtttcctcatggatccgcaccacaaccagcaatgaccaaaaggtcagcttctccgtacca
accggcaacttcggtgacatttgcgcaggccacatcgcccgccaaatgggacttcccatc
gatcgcctcatcgtggccaccaacgaaaacgatgtgctcgacgagttcttccgtaccggc
gactaccgagtccgcagctccgcagacacccacgagacctcctcaccttcgatggatatc
tcccgcgcctccaacttcgagcgtttcatcttcgacctgctcggccgcgacgccacccgc
gtcaacgatctatttggtacccaggttcgccaaggcggattctcactggctgatgacgcc
aactttgagaaggctgcagcagaatacggtttcgcctccggacgatccacccatgctgac
cgtgtggcaaccatcgctgacgtgcattcccgcctcgacgtactaatcgatccccacacc
gccgacggcgttcacgtggcacgccagtggagggacgaggtcaacaccccaatcatcgtc
ctagaaactgcactcccagtgaaatttgccgacaccatcgtcgaagcaattggtgaagca
cctcaaactccagagcgtttcgccgcgatcatggatgctccattcaaggtttccgaccta
ccaaacgacaccgatgcagttaagcagtacatagtcgatgcgattgcaaacacttccgtg
aagtaa

DBGET integrated database retrieval system