KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2139Help
Entry
NCgl2139          CDS       T00102                                 

Gene name
Cgl2220
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00260  Glycine, serine and threonine metabolism
cgl00750  Vitamin B6 metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01230  Biosynthesis of amino acids
Module
cgl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCgl2139 (Cgl2220)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NCgl2139 (Cgl2220)
Enzymes [BR:cgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NCgl2139 (Cgl2220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 1020172
NCBI-ProteinID: NP_601423
UniProt: P23669
Position
complement(2353598..2355043)
Genome map
AA seq 481 aa AA seqDB search
MDYISTRDASRTPARFSDILLGGLAPDGGLYLPATYPQLDDAQLSKWREVLANEGYAALA
AEVISLFVDDIPVEDIKAITARAYTYPKFNSEDIVPVTELEDNIYLGHLSEGPTAAFKDM
AMQLLGELFEYELRRRNETINILGATSGDTGSSAEYAMRGREGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADAEFKKDNRIGAVNSINWARLMAQVVYY
VSSWIRTTTSNDQKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTHETSSPSMDISRASNFERFIFDLLGRDATRVNDLFGTQVRQGGFSLADDA
NFEKAAAEYGFASGRSTHADRVATIADVHSRLDVLIDPHTADGVHVARQWRDEVNTPIIV
LETALPVKFADTIVEAIGEAPQTPERFAAIMDAPFKVSDLPNDTDAVKQYIVDAIANTSV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcgacgcgtgatgccagccgtacccctgcccgcttcagtgatattttg
ctgggcggtctagcaccagacggcggcctgtacctgcctgcaacctaccctcaactagat
gatgcccagctgagtaaatggcgtgaggtattagccaacgaaggatacgcagctttggct
gctgaagttatctccctgtttgttgatgacatcccagtagaagacatcaaggcgatcacc
gcacgcgcctacacctacccgaagttcaacagcgaagacatcgttcctgtcaccgaactc
gaggacaacatttacctgggccacctttccgaaggcccaaccgctgcattcaaagacatg
gccatgcagctgctcggcgaacttttcgaatacgagcttcgccgccgcaacgaaaccatc
aacatcctgggcgctacctctggcgataccggctcctctgcggaatacgccatgcgcggc
cgcgagggaatccgcgtattcatgctgaccccagctggccgcatgaccccattccagcaa
gcacagatgtttggccttgacgatccaaacatcttcaacatcgccctcgacggcgttttc
gacgattgccaagacgtagtcaaggctgtctccgccgacgcagaattcaaaaaagacaac
cgcatcggtgccgtgaactccatcaactgggcacgccttatggcacaggttgtgtactac
gtttcctcatggatccgcaccacaaccagcaatgaccaaaaggtcagcttctccgtacca
accggcaacttcggtgacatttgcgcaggccacatcgcccgccaaatgggacttcccatc
gatcgcctcatcgtggccaccaacgaaaacgatgtgctcgacgagttcttccgtaccggc
gactaccgagtccgcagctccgcagacacccacgagacctcctcaccttcgatggatatc
tcccgcgcctccaacttcgagcgtttcatcttcgacctgctcggccgcgacgccacccgc
gtcaacgatctatttggtacccaggttcgccaaggcggattctcactggctgatgacgcc
aactttgagaaggctgcagcagaatacggtttcgcctccggacgatccacccatgctgac
cgtgtggcaaccatcgctgacgtgcattcccgcctcgacgtactaatcgatccccacacc
gccgacggcgttcacgtggcacgccagtggagggacgaggtcaacaccccaatcatcgtc
ctagaaactgcactcccagtgaaatttgccgacaccatcgtcgaagcaattggtgaagca
cctcaaactccagagcgtttcgccgcgatcatggatgctccattcaaggtttccgaccta
ccaaacgacaccgatgcagttaagcagtacatagtcgatgcgattgcaaacacttccgtg
aagtaa

DBGET integrated database retrieval system