KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2246Help
Entry
NCgl2246          CDS       T00102                                 

Gene name
Cgl2328
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467078..2467926
Genome map
AA seq 282 aa AA seqDB search
MCELSYLNAVVMLKAQRGGNSGLYFGSMTTFITSGGLEISPAGAHIVHAESPEGELLFVS
SASQYGEGNAIRGGVPIIAPWFGGLLGLDPAHGWAKRSAWDVTEHDGQIHAEYGRDGLLL
DIRANSTKNGFEITLRAYNDTDEARTVQLAFHPYFKVDDVEKIEVRGLDGVDILNRLNNE
VETQDGPVTFDGEFDRIALGTPVVRIFDTDRIITIEGDGHDSTVVWNPGESRASTVADIG
EGEWRDFVCVEPALLGADQKGVRVAPGQSVTVGMQVSVEKRA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgaactttcataccttaacgcagtagtgatgcttaaggcacaacgtgggggcaat
tccggcctatactttggaagtatgactacttttattacctccggtggcttggaaatctcc
cccgctggcgctcatattgttcacgccgaatcacctgaaggtgagctgttgtttgttagc
tccgcttcccaatatggggagggaaatgcaattaggggtggtgtgcccatcattgctcca
tggtttggtggactgcttggtttggaccctgcacatggttgggcgaagcgttccgcgtgg
gacgtgactgaacatgacggccaaattcacgctgaatatggccgcgatggtttactgctg
gatattcgtgcgaacagcactaagaatggttttgagatcaccctgcgcgcttacaacgac
accgatgaggcacgcactgtgcagttggccttccacccttatttcaaggtggatgatgta
gaaaagatcgaggtccgtggccttgatggggtggacattctcaatcgcctgaacaatgag
gtggagacccaagatggtcccgttacttttgatggcgagttcgatcgcattgcgctaggg
actccggttgtgaggatttttgataccgatcgcatcatcaccattgagggcgatggtcat
gattccactgtggtgtggaatccaggcgaaagtcgcgcctccaccgtggccgatattggc
gaaggtgaatggcgcgactttgtgtgtgttgaaccggcgcttttgggtgctgaccaaaaa
ggagtgagggtggctccggggcagtcagtcaccgttgggatgcaggtaagcgtcgaaaag
cgtgcttag

DBGET integrated database retrieval system