KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2247Help
Entry
NCgl2247          CDS       T00102                                 

Gene name
Cgl2329
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl2247 (Cgl2329)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCgl2247 (Cgl2329)
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl2247 (Cgl2329)
Enzymes [BR:cgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCgl2247 (Cgl2329)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2467923..2470142)
Genome map
AA seq 739 aa AA seqDB search
MTEQELLSAQTADNAGTDSTERVDAGGMQVAKVLYDFVTEAVLPRVGVDAEKFWSGFAAI
ARDLTPRNRELLARRDELQMLIDDYHRNNSGTIDQEAYEDFLKEIGYLVEEPEAAEIRTQ
NVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPV
RGQKVIEWGREFLDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGN
FLDPEAILLETNGLHIELQIDPVHPIGKADKTGLKDIVLESAITTIMDFEDSVAAVDAED
KTLGYSNWFGLNTGELKEEMSKNGRIFTRELNKDRVYIGRNGTELVLHGRSLLFVRNVGH
LMQNPSILIDGEEIFEGIMDAVLTTVCAIPGIAPQNKMRNSRKGSIYIVKPKQHGPEEVA
FTNELFGRVEDLLDLPRHTLKVGVMDEERRTSVNLDASIMEVADRLAFINTGFLDRTGDE
IHTSMEAGAMVRKADMQTAPWKQAYENNNVDAGIQRGLPGKAQIGKGMWAMTELMAEMLE
KKIGQPREGANTAWVPSPTGATLHATHYHLVDVFKVQDELRAAGRRDSLRNILTIPTAPN
TNWSEEEKKEEMDNNCQSILGYVVRWVEHGVGCSKVPDIHDIDLMEDRATLRISSQMLAN
WIRHDVVSKEQVLESLERMAVVVDKQNAGDEAYRDMAPNYDASLAFQAAKDLIFEGTKSP
SGYTEPILHARRREFKAKN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggaactgttgtctgctcagactgccgacaacgctggaactgacagcacc
gaacgcgttgacgcgggcggaatgcaggttgcaaaagttctctacgactttgtaaccgaa
gcggtactccctcgcgtgggtgtggatgcggaaaagttctggtccggattcgccgccatc
gcccgggacctcaccccacgcaaccgcgagctgcttgctcgccgcgatgaactgcagatg
cttatcgacgactaccaccgcaacaactccggcaccatcgaccaagaggcgtacgaggat
ttcctcaaagaaatcggatacttggttgaggagccagaagctgcagaaatccgtacccaa
aacgtcgatacggaaatctccagcaccgcaggacctcagctggttgttccaattctgaac
gcacgcttcgcgctgaacgctgccaatgctcgctggggttccctctacgatgcgttgtac
ggcaccaacgccatcccagaaactgatggcgctgaaaagggcaaggagtacaacccggtc
cgcggccagaaggtcatcgagtggggtcgtgaattcctcgacagcgttgtcccactggac
ggtgcttcgcatgccgatgttgagaagtacaacatcaccgatggaaagcttgcagcccac
attggagatagcgtctaccgactgaaaaaccgtgaatcctaccgtggcttcaccggcaac
ttccttgatccagaagcaatcctgctggaaaccaacggcctgcacatcgagctgcagatc
gatcctgtccacccaatcggcaaggcagacaagactggtctcaaagacatcgttttggaa
tctgcgatcaccacgatcatggacttcgaagactccgttgcagctgttgatgctgaagac
aagaccttaggttactctaactggttcggactcaacaccggcgaactgaaagaagagatg
tccaagaacggacgcatcttcacccgtgagctcaacaaggaccgcgtctacattggccgc
aatggtaccgagctggttctgcacggtcgttccctgctgttcgtccgcaacgttggtcac
ctcatgcaaaacccatccatcttgattgatggcgaggagatcttcgaaggcatcatggat
gctgtcttgaccactgtttgtgccatcccaggaattgctccgcagaacaagatgcgcaat
tcccgcaagggctccatctacatcgtgaagcctaagcagcacggccctgaagaagtcgcg
ttcaccaacgagctcttcggccgcgttgaggatctgcttgatctgccacgccacaccttg
aaggttggtgttatggatgaggagcgtcgcacgtccgtgaacctggatgccagcatcatg
gaagttgctgaccgcttggcattcatcaacactggcttcctggaccgcaccggcgatgaa
atccacacctccatggaagcaggcgccatggtgcgcaaggctgatatgcagaccgcaccg
tggaagcaggcctacgagaacaacaacgttgatgcaggtattcagcgtggtcttcctggc
aaggctcagatcggtaagggcatgtgggcgatgactgaactcatggcagaaatgctggag
aagaagatcggccagccacgcgaaggcgccaacactgcatgggttccttcaccaactggt
gcgacgctgcacgcaacgcactaccacttggttgatgtgttcaaggttcaagacgaactg
cgtgctgccggccgccgcgacagcctgcgcaacattctcaccattccaaccgcaccaaac
accaattggtctgaggaagagaagaaggaagagatggacaacaactgccagtccatcctc
ggatacgttgtgcgctgggttgagcacggtgttggttgctccaaggttccagacatccat
gacatcgacctcatggaagaccgcgcaacgctgcgtatttcctcgcagatgctggccaac
tggatccgccatgatgttgtctcgaaggagcaggtcttggagtcactggaacgaatggca
gtggtcgtcgacaagcaaaatgcgggcgacgaggcctaccgcgatatggcgccgaactac
gacgcctccctcgccttccaggcggctaaggacttgattttcgaaggcaccaagtcccca
tcgggctacaccgagcccatcttgcacgcacgccgccgcgagttcaaagcaaaaaactaa

DBGET integrated database retrieval system