KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2248Help
Entry
NCgl2248          CDS       T00102                                 

Gene name
Cgl2331
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCgl2248 (Cgl2331)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl2248 (Cgl2331)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCgl2248 (Cgl2331)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470741..2472039
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDTNPRWNGITRDYTADQVADLQGSVIEEHTLARRGSEILWDAV
TQEGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRSDEIARTEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMTSFVDLQNREFKAAEERGFTAVKHQREVGAGYFDQIATTVDPNSSTTA
LKGSTEEGQFHN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaaagccacgtaccgcacaggaaatccagcaggattgggacaccaac
cctcgttggaacggcatcacccgcgactacaccgcagaccaggtagctgatctgcagggt
tccgtcatcgaggagcacactcttgctcgccgcggctcagagatcctctgggacgcagtc
acccaggaaggtgacggatacatcaacgcgcttggcgcactcaccggtaaccaggctgtt
cagcaggttcgtgcaggcctgaaggctgtctacctgtccggttggcaggtcgcaggtgac
gccaacctctccggccacacctaccctgaccagtccctctacccagcgaactccgttcca
agcgtcgttcgtcgcatcaacaacgcactgctgcgttccgatgaaatcgcacgcaccgaa
ggcgacacctccgttgacaactgggttgtcccaatcgtcgcggacggcgaagctggcttc
ggtggagcactcaacgtctacgaactccagaaggcaatgatcgcagctggcgctgcaggc
acccactgggaagaccagctcgcttctgaaaagaagtgtggccacctcggcggcaaggtt
ctgatcccaacccagcagcacatccgcaccctgaactctgcccgccttgcagcagacgtt
gcaaacaccccaactgttgttatcgcacgtaccgacgctgaggcagcaaccctgatcacc
tctgacgttgatgagcgcgaccaaccattcatcaccggtgagcgcaccgcagaaggctac
taccacgtcaagaatggtctcgagccatgtatcgcacgtgcaaagtcctacgcaccatac
gcagatatgatctggatggagaccggcacccctgacctggagctcgctaagaagttcgct
gaaggcgttcgctctgagttcccagaccagctgctgtcctacaactgctccccatccttc
aactggtctgcacacctcgaggcagatgagatcgctaagttccagaaggaactcggcgca
atgggcttcaagttccagttcatcaccctcgcaggcttccactccctcaactacggcatg
ttcgacctggcttacggatacgctcgcgaaggcatgacctccttcgttgacctgcagaac
cgtgagttcaaggcagctgaagagcgtggcttcaccgctgttaagcaccagcgtgaggtt
ggcgcaggctacttcgaccagatcgcaaccaccgttgacccgaactcttctaccaccgct
ttgaagggttccactgaagaaggccagttccacaactag

DBGET integrated database retrieval system