KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2274Help
Entry
NCgl2274          CDS       T00102                                 

Gene name
Cgl2356
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00330  Arginine and proline metabolism
cgl00332  Carbapenem biosynthesis
cgl01100  Metabolic pathways
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCgl2274 (Cgl2356)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NCgl2274 (Cgl2356)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NCgl2274 (Cgl2356)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 1020307
NCBI-ProteinID: NP_601557
UniProt: P0C1E2
Position
complement(2496668..2497777)
Genome map
AA seq 369 aa AA seqDB search
MRERISNAKRVVVKIGSSSLTNDEDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVA
AGMAPLGLSTRPTELAVKQAAAAVGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRA
RNAQRTIDKLRILGAVPIVNENDTVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGL
FDKNPTDPTAKFISEVRDGNDLKGVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSA
ANIGPALEDAQVGTVFHPKDNRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAV
GITEIIGDFQQGEIVEILGPAGQIIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHAD
YLSNYASRA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattg
actaacgatgaggacggacacaccgtcgatcccaaccgcatcaacactattgtcaatgcc
ttgcaagcacgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggcc
gcgggaatggccccgcttggattgagcacccggcccacggaattggcagtcaagcaggct
gcagcagcagtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtat
ggtcgccccatcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcg
aggaatgcgcagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaat
gaaaatgacaccgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgca
attgtggcgcacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactt
tttgataaaaaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaat
gatttgaaaggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatca
aaggtgtctgctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcg
gcaaacattggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggac
aaccgcctctccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatc
cgactcgatgacggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtg
ggcattactgaaatcattggtgatttccagcagggtgagatcgtggagatcttgggacct
gccggccaaatcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatg
gttggtatgcaaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagat
tatctgtccaactacgccagccgcgcgtaa

DBGET integrated database retrieval system