KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2309Help
Entry
NCgl2309          CDS       T00102                                 

Gene name
Cgl2392
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCgl2309 (Cgl2392)
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl2309 (Cgl2392)
   00640 Propanoate metabolism
    NCgl2309 (Cgl2392)
   00650 Butanoate metabolism
    NCgl2309 (Cgl2392)
  Lipid metabolism
   00071 Fatty acid degradation
    NCgl2309 (Cgl2392)
   00072 Synthesis and degradation of ketone bodies
    NCgl2309 (Cgl2392)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCgl2309 (Cgl2392)
   00310 Lysine degradation
    NCgl2309 (Cgl2392)
   00380 Tryptophan metabolism
    NCgl2309 (Cgl2392)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCgl2309 (Cgl2392)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCgl2309 (Cgl2392)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NCgl2309 (Cgl2392)
Enzymes [BR:cgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCgl2309 (Cgl2392)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCgl2309 (Cgl2392)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2534202..2535428
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggcgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgagacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system