KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2371Help
Entry
NCgl2371          CDS       T00102                                 

Gene name
Cgl2457
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cgl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cgl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cgl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2601462..2602883
Genome map
AA seq 473 aa AA seqDB search
MSFKRRSLAITCAITSSIVLAGISGTAAAQSSYVSGSSGLLSSSELHPETPAPLDAPKNI
IYMIGDGMGYNHVSATNLFETGQTMHQVEGEPGSVTPVEGGTPVQAFEGAEWTQLAQSTF
QDGNSYDPERAWADHNYVNENFTDSAAAGTAMATGVKTTNGMIGINPANEPAKNTSEYAI
EKGKAAGVVSSVPFNHATPAAWAAHNSNRNDLHAMAEEMINSDLNVIMGAGHPFFDNNGN
PITEADEDYMQASQYERLASGETDFTFVEEDADFEALANGQVESDKYFGLAQVEDPLQHD
RDGDSVTPYDVPLNDVVDLSTMSKAALNVLNQDEDGFHIMIEGGAIDWAGHANDMARDIE
EVQEFNKAVETVIEWVETNSSWDETLVIVTADHETGYMTGPNDDPNWSAMTGAAGIVPNH
GWHSGNHINQLVPVFARGAGVSDIVAAADQVDPIRGNYIDNIEIANLTFNKWW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaagcgtcgttcgcttgcaatcacttgcgccatcacctccagcattgttctc
gctggaatctccggcaccgctgccgcccagtcctcctacgtttctggatcctcaggactg
ctgtcctccagcgagctccatcctgaaactccagcacctctggatgctccaaagaacatc
atctacatgatcggtgacggcatgggttacaaccatgtctccgcaaccaacctgtttgaa
accggccagaccatgcaccaggtcgaaggcgagccaggttctgtcaccccagttgagggt
ggcactccagttcaggcatttgaaggcgctgagtggacccagcttgcacagtccaccttc
caggatggaaactcctacgaccctgagcgcgcgtgggctgatcacaactatgtcaatgag
aacttcaccgactccgctgctgcaggaaccgcaatggcaaccggcgttaagaccaccaac
ggcatgatcggcatcaacccagccaacgagcctgcgaagaacacctctgagtacgcaatt
gaaaagggcaaggcagccggcgttgtttcctctgttcctttcaaccacgcaactcctgcg
gcttgggcagctcacaactccaaccgcaatgatctgcacgcgatggccgaagagatgatc
aacagtgatctcaacgtcatcatgggtgctggccacccattcttcgacaacaacggcaac
ccaatcacagaagccgacgaagactacatgcaggcttcccagtacgagcgcctcgcaagt
ggcgaaaccgacttcaccttcgtcgaagaggacgcagacttcgaggctctcgcaaacggc
caagttgaaagtgacaagtacttcggtctcgcgcaggtcgaagacccccttcagcacgac
cgcgatggcgactctgtcactccttacgacgttccactcaacgacgtcgtcgacctttcc
accatgtccaaggcagccctcaacgttcttaaccaggacgaagacggattccacatcatg
atcgaaggtggcgcaatcgactgggcaggccacgcaaatgacatggctcgcgacattgaa
gaagtccaagagttcaacaaggccgttgaaactgtcatcgagtgggttgagaccaactcc
tcttgggatgaaaccctcgtgatcgtcaccgccgaccacgaaaccggctacatgaccggc
cctaacgatgatccaaactggtccgcaatgaccggcgctgcaggcatcgttccaaaccac
ggctggcactccggtaaccacatcaaccagctcgtcccagtgttcgctcgtggcgcaggt
gtctccgatatcgttgctgctgccgatcaagttgacccaattcgcgggaattacatcgac
aacattgagatcgcgaacctgactttcaacaagtggtggtaa

DBGET integrated database retrieval system