KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2371Help
Entry
NCgl2371          CDS       T00102                                 

Gene name
Cgl2457
Definition
(RefSeq) alkaline phosphatase (EC:3.1.3.1)
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NCgl2371 (Cgl2457)
   00790 Folate biosynthesis
    NCgl2371 (Cgl2457)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NCgl2371 (Cgl2457)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NCgl2371 (Cgl2457)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCgl2371 (Cgl2457)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCgl2371 (Cgl2457)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cgl00537]
 Enzymes
  NCgl2371 (Cgl2457)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2601462..2602883
Genome map
AA seq 473 aa AA seqDB search
MSFKRRSLAITCAITSSIVLAGISGTAAAQSSYVSGSSGLLSSSELHPETPAPLDAPKNI
IYMIGDGMGYNHVSATNLFETGQTMHQVEGEPGSVTPVEGGTPVQAFEGAEWTQLAQSTF
QDGNSYDPERAWADHNYVNENFTDSAAAGTAMATGVKTTNGMIGINPANEPAKNTSEYAI
EKGKAAGVVSSVPFNHATPAAWAAHNSNRNDLHAMAEEMINSDLNVIMGAGHPFFDNNGN
PITEADEDYMQASQYERLASGETDFTFVEEDADFEALANGQVESDKYFGLAQVEDPLQHD
RDGDSVTPYDVPLNDVVDLSTMSKAALNVLNQDEDGFHIMIEGGAIDWAGHANDMARDIE
EVQEFNKAVETVIEWVETNSSWDETLVIVTADHETGYMTGPNDDPNWSAMTGAAGIVPNH
GWHSGNHINQLVPVFARGAGVSDIVAAADQVDPIRGNYIDNIEIANLTFNKWW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaagcgtcgttcgcttgcaatcacttgcgccatcacctccagcattgttctc
gctggaatctccggcaccgctgccgcccagtcctcctacgtttctggatcctcaggactg
ctgtcctccagcgagctccatcctgaaactccagcacctctggatgctccaaagaacatc
atctacatgatcggtgacggcatgggttacaaccatgtctccgcaaccaacctgtttgaa
accggccagaccatgcaccaggtcgaaggcgagccaggttctgtcaccccagttgagggt
ggcactccagttcaggcatttgaaggcgctgagtggacccagcttgcacagtccaccttc
caggatggaaactcctacgaccctgagcgcgcgtgggctgatcacaactatgtcaatgag
aacttcaccgactccgctgctgcaggaaccgcaatggcaaccggcgttaagaccaccaac
ggcatgatcggcatcaacccagccaacgagcctgcgaagaacacctctgagtacgcaatt
gaaaagggcaaggcagccggcgttgtttcctctgttcctttcaaccacgcaactcctgcg
gcttgggcagctcacaactccaaccgcaatgatctgcacgcgatggccgaagagatgatc
aacagtgatctcaacgtcatcatgggtgctggccacccattcttcgacaacaacggcaac
ccaatcacagaagccgacgaagactacatgcaggcttcccagtacgagcgcctcgcaagt
ggcgaaaccgacttcaccttcgtcgaagaggacgcagacttcgaggctctcgcaaacggc
caagttgaaagtgacaagtacttcggtctcgcgcaggtcgaagacccccttcagcacgac
cgcgatggcgactctgtcactccttacgacgttccactcaacgacgtcgtcgacctttcc
accatgtccaaggcagccctcaacgttcttaaccaggacgaagacggattccacatcatg
atcgaaggtggcgcaatcgactgggcaggccacgcaaatgacatggctcgcgacattgaa
gaagtccaagagttcaacaaggccgttgaaactgtcatcgagtgggttgagaccaactcc
tcttgggatgaaaccctcgtgatcgtcaccgccgaccacgaaaccggctacatgaccggc
cctaacgatgatccaaactggtccgcaatgaccggcgctgcaggcatcgttccaaaccac
ggctggcactccggtaaccacatcaaccagctcgtcccagtgttcgctcgtggcgcaggt
gtctccgatatcgttgctgctgccgatcaagttgacccaattcgcgggaattacatcgac
aacattgagatcgcgaacctgactttcaacaagtggtggtaa

DBGET integrated database retrieval system