KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2401Help
Entry
NCgl2401          CDS       T00102                                 

Gene name
Cgl2487
Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cgl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2632544..2633104
Genome map
AA seq 186 aa AA seqDB search
MARALILVDVQKDFCPGGSLATERGDEVAGKIGAYQLSHGSEYDVVVATQDWHIDPGEHF
SETPDFKNSWPIHCVADSDGAAMHDRINTDSIDEFFRKGHYTAAYSGFEGTAVSEELLMS
PWLKNKGVTDVDIVGIATDHCVRATALDALKEGFNVSILTSMCSAVDFHAGDHALEELHE
AGAILI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgcactcattctggttgatgttcaaaaagacttctgccccggtggcagccta
gccaccgaacgaggcgatgaagtggcgggaaaaatcggtgcctatcagctgtcccacggc
tcagagtacgacgtcgttgtggcgacccaagattggcacatcgatccaggcgagcacttt
tcagaaaccccagactttaaaaactcctggccaatccactgcgtcgcggattccgatggt
gccgccatgcatgaccgcatcaacaccgattcaatcgatgagttcttccgcaaaggccat
tacaccgcggcgtattccgggttcgagggaactgcagtcagtgaagaactcctcatgtct
ccatggctgaagaacaagggagtcactgatgtagacatcgtagggatcgctacggatcac
tgcgttcgagccacagcacttgatgctctcaaggagggcttcaacgtctccattttgacg
tcgatgtgttctgcggtggatttccatgcgggagaccacgctttggaggaactacatgaa
gccggggcgattctgatttaa

DBGET integrated database retrieval system